Details for Chinese cabbage Locus Brara.E03354

Position : A05 ( 5`- 26955433 .. 26957435 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03354

Protein [Map View]
MTTTMTTEGMMMEISMVDDIIRRLLEGKGGKQVQLSEIEIRQLCVNARQIFLSQPNLLDLHAPIRICGDIHGQYQDLLRL
FEYGGYPPSANYLFLGDYVDRGKQSLETICLLLAYKIRYPSKVFLLRGNHEDAKINRIYGFYDECKRRFNVRLWKVFTDC
FNCLPVAALIDDKILCMHGGLSPELENLEQIREIQRPTEIPDNGLLCDLLWSDPDQKHEGWCDSDRGISCTFGADVVAEF
LDKNDLDLICRGHQVVEDGYEFFAKRRLVTIFSAPNYGGEFDNAGALLSVDQSLVCSFEILKPAPSSSSIPLKKVPKMGK
S*

DNA
ATGACGACGACGATGACAACAGAAGGGATGATGATGGAGATAAGTATGGTGGATGACATCATCAGAAGATTATTAGAAGG
CAAAGGAGGCAAACAGGTCCAGCTCTCAGAGATCGAGATCCGTCAACTCTGCGTTAACGCCAGACAAATCTTCCTCTCTC
AGCCTAACCTCCTCGATCTCCATGCCCCCATTCGCATCTGCGGTGATATTCATGGACAATACCAAGACCTTCTCCGTCTA
TTCGAATACGGAGGCTACCCTCCTTCAGCCAACTACCTCTTCCTCGGCGACTACGTCGACAGAGGCAAGCAGAGCCTCGA
GACGATCTGCCTCCTCTTGGCTTACAAAATCCGCTACCCGTCCAAGGTCTTCCTCCTGAGAGGCAACCACGAGGACGCGA
AGATCAACAGGATCTACGGCTTCTACGACGAGTGCAAACGGAGGTTCAACGTCAGGCTGTGGAAGGTATTCACCGACTGC
TTCAACTGCCTGCCCGTTGCCGCCCTCATCGACGACAAGATCTTGTGTATGCACGGAGGGTTGTCGCCGGAGCTGGAGAA
TTTGGAGCAGATTAGGGAGATTCAGAGGCCTACTGAGATTCCGGACAACGGTCTTCTTTGTGATTTGCTTTGGTCGGATC
CGGATCAGAAGCATGAAGGATGGTGTGATAGCGATAGGGGTATCTCGTGTACGTTTGGAGCTGATGTAGTTGCTGAGTTC
TTGGATAAAAATGATCTTGACCTCATTTGCCGTGGCCATCAGGTGGTGGAAGATGGGTATGAGTTTTTTGCGAAAAGGAG
ATTAGTGACGATATTCTCAGCTCCAAACTATGGTGGAGAGTTTGACAATGCAGGTGCATTATTGAGCGTGGACCAATCTC
TTGTTTGCTCTTTTGAGATTCTGAAACCTGCCCCATCTTCAAGCAGTATCCCTCTCAAGAAGGTACCTAAAATGGGAAAG
TCTTGA