Details for Chinese cabbage Locus Brara.E03349

Position : A05 ( 5`- 26938020 .. 26941424 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03349

Protein [Map View]
MGKRNNLKRRVRSKEKGLDEDYVISDEDESEGDDLNEDSFDGCAVEEDEVEVEEEEVVLRSVEWPKVKTGPRGNRKITGC
RSRKVEQVVVVVSDKEEDEDLDDAEEDERESVKEIGFGKRRRVFYEVEDEDGDYPEEEDVSCEKEEMALEEQENVSQEKE
KEDDGDYDEDEDGDEEFTADEEDVSLDEEDEEEETLKVCKRNKRKQRSRGGGRKRRNVASGRKRRGKNAKEGVDDDDGDF
VNDCLPVRKRARSLRPRRRCTLQSDSDIASSGESDYEYTISEEEREQVREVSSLLRSNVKHMSSTRKATVHPQLRKSPVK
KSEKKVEIVMKNVCGICLSKEDMRRLKGTLDCCSHYFCFTCIMEWSKVESRCPLCKQRFRTISKPARSTHGVDLREVVIR
VPERDQVYQPTEEELRSYLDPYENIICSECHQGEDDGLMLLCDLCDSSAHTYCVGLGREVPEGNWFCDACRPVALGTAIS
QMHATSEPQRVTGFYSRPSPLVVSGQYQDPSSLVSPRTPFSSGDYLFSSRNGDVQGSSPFGLGATTLSRRRTLHRHIQNI
INSDRLVNMGSSRTGGSSMIANSSDGREREPPQHVATLETRMSLYTISEERLHNEPELLSPKLDHFGSDEAARRFSSNTF
RGDRPIDLELHYGLAQGDPLFGNQQHPRSYMPNTMSLTGGERLQQRVKAHLQNLSRQINLGHATFEEISTCSIHTILAAC
GLEHKSSEVHFVPPSVTCPHDDMRPGSSSGNNNNSSSSSLMKGCCSSCFDSFVEDVVKMILDTRQPHWLRLGLH*

DNA
ATGGGGAAGAGAAACAATTTAAAGAGAAGAGTTAGATCTAAGGAAAAGGGCTTAGATGAGGATTATGTGATATCAGACGA
AGATGAATCTGAAGGTGATGATCTGAATGAGGATTCTTTTGATGGTTGTGCTGTGGAGGAGGATGAGGTGGAGGTGGAGG
AGGAGGAGGTTGTGCTGAGGAGCGTTGAGTGGCCGAAAGTGAAGACCGGTCCACGTGGCAATCGGAAGATCACGGGATGC
AGGTCGAGAAAGGTGGAGCAGGTTGTTGTTGTTGTTTCTGATAAGGAAGAAGATGAGGATCTTGATGATGCTGAGGAGGA
TGAGAGGGAGAGTGTGAAAGAGATTGGTTTTGGTAAGAGGAGGAGAGTTTTCTATGAGGTGGAAGATGAAGATGGAGACT
ATCCAGAAGAGGAAGATGTGAGCTGTGAAAAGGAAGAGATGGCGTTGGAGGAGCAGGAGAATGTGTCACAGGAGAAGGAG
AAGGAAGATGATGGAGATTATGATGAGGATGAGGATGGGGACGAAGAGTTTACCGCGGATGAGGAAGATGTCTCACTAGA
TGAGGAAGATGAGGAGGAAGAAACGCTCAAGGTTTGTAAGAGAAACAAGCGGAAGCAGAGATCTAGAGGAGGAGGGCGTA
AAAGAAGAAATGTTGCAAGTGGAAGGAAGAGACGAGGGAAGAACGCAAAGGAAGGAGTTGATGATGATGATGGTGATTTT
GTAAATGACTGCCTACCTGTAAGAAAGAGGGCGAGATCATTAAGACCAAGGCGTCGGTGTACTTTACAATCAGATTCAGA
CATTGCCTCCTCTGGAGAGTCTGATTACGAGTACACAATCTCAGAGGAGGAAAGAGAGCAGGTAAGGGAAGTCAGTAGTC
TATTGAGAAGTAACGTGAAACACATGTCATCTACACGAAAAGCTACGGTCCACCCTCAGCTTCGTAAATCACCTGTGAAG
AAAAGTGAAAAGAAGGTAGAGATAGTGATGAAAAACGTTTGTGGGATTTGTCTGTCTAAGGAAGACATGAGGAGATTAAA
AGGAACACTGGACTGTTGTAGTCATTACTTTTGTTTCACTTGCATTATGGAGTGGTCAAAAGTAGAATCTCGATGCCCTC
TGTGTAAGCAGCGGTTCAGAACAATTAGTAAGCCTGCAAGATCCACACATGGTGTTGATTTGAGAGAAGTCGTGATACGT
GTACCTGAACGTGATCAGGTCTATCAACCCACTGAGGAAGAGCTGAGGAGTTATCTCGATCCATACGAAAATATAATATG
CTCGGAGTGTCACCAAGGTGAAGACGATGGGCTTATGCTGCTTTGTGATCTTTGTGATTCATCTGCTCATACGTACTGTG
TTGGACTCGGGAGGGAAGTGCCTGAAGGAAACTGGTTCTGTGATGCTTGTAGACCTGTTGCACTTGGAACAGCTATCTCC
CAGATGCATGCTACATCCGAGCCACAAAGGGTGACTGGCTTTTACAGTAGACCATCGCCTCTTGTTGTTTCAGGGCAATA
TCAAGATCCGTCTTCGCTAGTATCCCCACGTACACCTTTTTCCAGTGGAGATTACCTTTTCTCTTCAAGGAATGGTGATG
TTCAAGGCTCTTCTCCTTTCGGCTTAGGGGCAACCACGTTATCAAGACGAAGGACGCTTCATAGACACATACAAAATATT
ATCAACAGTGATAGGCTTGTTAATATGGGGAGTAGTAGAACTGGTGGATCATCGATGATTGCTAACTCGAGTGATGGCAG
AGAAAGAGAACCGCCTCAACATGTAGCGACCCTAGAAACAAGGATGTCGTTGTATACAATCTCTGAGGAGAGATTGCACA
ATGAACCTGAGCTTTTGTCTCCGAAGTTAGATCATTTTGGAAGCGATGAAGCAGCGAGACGTTTCTCTAGTAATACATTC
CGTGGTGATCGACCTATTGATTTAGAACTGCATTATGGATTGGCTCAGGGTGATCCTTTGTTTGGTAATCAACAACATCC
ACGCAGCTACATGCCAAACACAATGTCTTTGACGGGAGGAGAACGACTGCAACAAAGAGTTAAAGCCCATCTCCAGAACT
TGTCTCGTCAAATCAACTTAGGTCACGCCACGTTTGAGGAGATTTCCACGTGCTCAATACACACGATACTGGCAGCTTGT
GGACTGGAACACAAGAGCAGTGAAGTCCACTTTGTCCCGCCGTCAGTGACGTGTCCTCACGATGATATGAGACCTGGGAG
CAGCAGTGGTAACAACAACAACAGCAGCAGCAGCAGCCTGATGAAAGGGTGTTGCTCTTCTTGTTTTGATTCATTTGTAG
AAGATGTAGTTAAGATGATTCTGGACACAAGACAACCCCATTGGTTGAGGTTAGGGCTCCACTGA