Details for Chinese cabbage Locus Brara.E03345

Position : A05 ( 5`- 26927918 .. 26928541 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03345

Protein [Map View]
MAKTLSSICFTTLLLVVLLISAGIPKSEATCTKYLGEAILAYPCKESYCEAKCAESYHESCRGECEDHDHHHGVHLTNDH
DDHCHCYGRY*

DNA
ATGGCAAAGACCCTCAGTTCCATCTGCTTCACCACTCTCTTGCTCGTTGTCTTGTTGATTTCAGCTGGAATCCCGAAGAG
CGAGGCGACGTGTACGAAGTACTTAGGCGAAGCCATATTGGCGTACCCATGCAAGGAAAGCTACTGTGAAGCCAAATGCG
CTGAGTCTTACCACGAGTCATGCAGAGGAGAGTGTGAGGATCATGATCACCACCACGGAGTGCATTTAACAAATGACCAT
GACGACCATTGCCACTGCTACGGTCGTTATTAA