Details for Chinese cabbage Locus Brara.E03343

Position : A05 ( 5`- 26917549 .. 26920808 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03343

Protein [Map View]
MIETEAVERKRSRGGFLTLFDWSGKSRKKLLSSTTTTSGPSEASKQEKQNAQNPSKSSSPSIELEETGKSVTYSPRRDSS
CSTSTVTSDDRQGSRAPSVVARLMGLESLPVPNSLEQPRSNPDFDPFFLSSSRKASTWDAYESLGYVNLRSHYDGVSWDH
LDSKTNNNESHRLPINRFQTETLPPKSAKPISVTHNRLLSPIRSPGFVQSRNPAQVMEAASRMIEPSARIAAAKARFSSS
SEASSSIPMRIRDLREKLEAPQNKQTPQISNGSRNNNKYLRGKNESSSLKTQEANKLLGKTSRVKPPSVSAHTKTNTIHK
QESSTSSTSNRVQKEKVQTKNRIVKKDPKESSASSTGKALAKQNNQKQNQLAVTSVTKQKGSKVMNKVVNKVLVESGTSS
KKPGPKKNLPRNKKPANGLQEPGVISEKLIKRGEKLKKCNISVEGDRKKEMDVISFTFSSPIKGISSTKRTTDQERDSAL
SLSAINGDSLNILLEQKLRELTSKIESSSSSLTQEGESSGSISKDWVNGTISLPSDDLDKVSSENESVSDCTSFYNNRKF
QAEELEVNSFGTEAEDLQGSNSHNEIEETKLSESVTLAEAEEEGHRDWELEYITEIISSNQLMVKEISLGMATNILPWSL
FDELESKRDPRGNLERKTLFEFVNECLTLKCEKMFMGSCRGSFLFGRKEVLAEEVKREIGRLKKMREMMMVDELVDSEMS
SFEGRWLDYKREAYEEGSEIEEEILSDLVDELVNDLLLCY*

DNA
ATGATAGAAACGGAGGCTGTTGAGAGGAAACGATCGAGAGGAGGGTTTTTAACTCTCTTTGATTGGTCTGGTAAATCCCG
GAAGAAGCTCCTCTCCTCTACCACCACCACCTCTGGACCCTCCGAAGCATCAAAGCAAGAGAAACAAAATGCTCAAAACC
CCTCAAAGTCATCATCCCCATCTATTGAGCTTGAGGAGACAGGAAAGAGTGTAACTTACAGTCCAAGAAGGGACTCTAGC
TGCTCTACATCCACTGTCACCAGCGATGATAGACAAGGGTCTAGAGCCCCGAGTGTGGTCGCCAGGCTCATGGGTTTGGA
GTCTCTACCCGTACCAAACTCCCTGGAACAACCTCGGTCTAATCCTGATTTTGATCCGTTCTTCCTCAGTTCCTCACGCA
AGGCAAGCACATGGGATGCGTACGAGAGTTTGGGCTATGTGAACCTCCGCAGTCACTATGATGGCGTTTCTTGGGATCAT
TTGGATTCAAAAACGAATAACAACGAGTCTCACCGGTTACCTATTAACCGCTTTCAAACCGAAACGTTGCCTCCAAAGTC
GGCTAAACCAATCTCCGTCACTCACAACAGGCTCCTGTCGCCCATCCGGAGTCCTGGTTTTGTTCAGTCCAGGAACCCTG
CTCAAGTTATGGAAGCAGCTTCGAGAATGATCGAGCCAAGTGCTCGGATAGCTGCTGCTAAAGCACGTTTTTCATCATCA
TCTGAGGCTTCTTCATCGATTCCAATGAGGATCAGAGATTTGAGAGAGAAGCTAGAAGCTCCACAGAACAAACAAACTCC
ACAAATCTCTAATGGTAGCCGCAACAATAATAAGTATTTAAGAGGGAAGAACGAATCATCATCACTCAAGACACAGGAGG
CAAATAAGTTATTGGGCAAAACCAGTAGAGTGAAGCCGCCTTCTGTATCTGCACACACAAAGACCAATACTATTCACAAG
CAAGAGAGCTCAACGTCTTCAACTAGCAACAGAGTTCAAAAGGAGAAGGTACAAACCAAGAACCGCATAGTTAAAAAGGA
TCCAAAAGAATCTTCTGCTAGCAGCACTGGGAAAGCTCTGGCTAAGCAAAATAACCAGAAACAGAACCAATTAGCTGTGA
CGTCTGTTACAAAACAGAAAGGCAGCAAAGTGATGAACAAAGTTGTAAACAAGGTGTTGGTGGAAAGCGGAACTTCATCT
AAAAAGCCTGGTCCTAAAAAGAATCTTCCTCGCAACAAAAAACCGGCAAATGGGTTGCAAGAGCCTGGAGTGATCAGTGA
GAAACTGATCAAAAGGGGTGAGAAGTTGAAGAAATGCAACATCAGTGTTGAAGGTGATAGGAAGAAGGAGATGGATGTGA
TTTCATTCACTTTCTCATCCCCTATCAAGGGCATATCATCCACTAAAAGGACCACCGATCAAGAAAGAGATTCTGCACTT
AGTTTGAGTGCAATCAATGGTGATTCTCTAAACATTCTGTTGGAACAAAAGCTTAGAGAGCTAACCTCTAAGATTGAGTC
ATCTAGCAGTAGCCTTACACAAGAGGGAGAGTCTTCAGGCTCCATTTCAAAGGATTGGGTGAATGGAACTATATCATTGC
CATCAGATGATCTTGATAAAGTTTCGTCAGAGAATGAATCTGTTTCTGACTGTACTTCTTTCTACAATAACCGAAAATTT
CAGGCAGAAGAGCTGGAAGTAAACAGCTTTGGAACAGAAGCTGAGGATCTCCAAGGCTCAAATTCACACAATGAGATTGA
AGAAACAAAACTCTCAGAATCAGTTACTTTAGCAGAAGCTGAAGAAGAAGGCCATCGTGACTGGGAGCTAGAGTACATAA
CCGAGATCATATCCTCTAACCAACTGATGGTGAAAGAAATCTCCTTGGGGATGGCTACTAATATATTACCTTGGAGCCTC
TTCGACGAACTCGAATCCAAGAGAGATCCACGTGGAAACCTAGAGAGAAAAACGCTGTTTGAGTTTGTGAACGAGTGCTT
GACACTCAAATGCGAGAAGATGTTCATGGGAAGCTGCAGAGGATCGTTTTTGTTTGGAAGGAAAGAGGTTTTAGCTGAGG
AAGTGAAGAGAGAGATTGGGAGGTTGAAGAAGATGAGGGAGATGATGATGGTGGATGAGCTGGTTGACAGTGAGATGAGT
AGCTTTGAAGGGAGATGGCTTGATTACAAGAGAGAGGCGTACGAAGAAGGGAGTGAGATTGAAGAAGAGATTTTGTCTGA
TTTAGTTGATGAGTTAGTTAATGATCTTCTCTTGTGTTATTAA