Details for Chinese cabbage Locus Brara.E03342

Position : A05 ( 5`- 26914858 .. 26916800 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03342

Protein [Map View]
TPGVDNTFRKKFDTEEYRERARKREEKEADRSKSQPKGPPVQRAPLKHRDYHVDLESRLGKTQVVTPVAPLSQQAGYFCR
VCDCVVKDSANYLDHINGKKHQRALGMSMRVERSSLEQVQERFEVLKKRKTPGTFSEQDLDERIRKQQEEEEEHKRQRRE
KKKEKKKGKVIEEEPEMDPEVAELMGFGGFGSSKKS*

DNA
ACTCCAGGGGTTGATAACACGTTCAGAAAGAAGTTCGATACGGAAGAGTATCGAGAACGTGCACGTAAACGCGAAGAGAA
GGAGGCGGATCGGTCTAAATCTCAGCCTAAAGGTCCTCCTGTGCAAAGAGCTCCTTTGAAGCATAGAGATTATCATGTAG
ACTTAGAGTCTCGTCTCGGCAAGACCCAGGTTGTTACACCGGTAGCGCCTCTAAGTCAGCAGGCTGGTTATTTCTGTCGC
GTTTGTGACTGTGTTGTTAAAGATTCAGCTAACTACTTGGATCACATTAATGGGAAAAAACATCAAAGGGCGTTGGGAAT
GTCTATGCGGGTGGAGAGATCATCACTTGAACAGGTCCAGGAGCGGTTCGAGGTGTTAAAGAAACGGAAAACGCCAGGAA
CTTTCTCAGAACAAGACCTGGACGAACGGATCCGGAAACAGCAAGAAGAAGAGGAGGAACATAAACGGCAGCGGAGGGAG
AAAAAGAAAGAGAAGAAGAAAGGGAAGGTGATAGAGGAGGAGCCTGAGATGGATCCCGAGGTTGCAGAGCTGATGGGATT
TGGGGGCTTTGGATCTTCCAAAAAATCATGA