Details for Chinese cabbage Locus Brara.E03341

Position : A05 ( 5`- 26912085 .. 26914230 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03341

Protein [Map View]
MANNFPDEFHGATPIWFGGLEGEDTLVQESVYPHDLIAKFYFAKKRLMWEILDEDSKLKRKIEMQWSDVLSFRASFPPQN
ETGTLEVELGKCPTFFLEVNPQRAKHTQWKQLDQDFTPGQSASKYRRHTLQISPGDLKMNLEKLVSAVSFWSKLAKVNFP
TLPQSLYFDNGNSNNNGNSNLCPNGNCTTLGINGNHLYPQVENVNFNMATELCPNNQMNPIFQDDHQDETMSQLPGMQVT
HPSSQHINMGRYIISGSHFNNPMIPDDRHTSNTGKLRGPYLQDILAQEEVIQNMKCVRQFQTNGGYCNCNQCFNNINGSL
PPDS*

DNA
ATGGCTAATAATTTCCCTGATGAATTCCATGGAGCAACACCGATCTGGTTTGGAGGTTTGGAAGGCGAAGACACCCTGGT
CCAAGAGTCGGTCTACCCTCATGATCTTATTGCCAAATTCTACTTTGCAAAGAAGAGACTTATGTGGGAGATTCTCGATG
AAGATTCAAAACTTAAGAGAAAGATTGAGATGCAATGGTCTGATGTCTTGTCTTTTAGAGCTAGTTTTCCTCCACAAAAT
GAAACAGGAACACTAGAAGTCGAGTTGGGAAAGTGTCCAACGTTCTTCTTGGAGGTTAATCCACAGCGAGCAAAGCACAC
TCAATGGAAACAGTTGGATCAAGACTTTACCCCAGGTCAATCTGCTTCTAAATACAGGAGACATACACTTCAGATTTCCC
CTGGAGATCTGAAGATGAACTTGGAGAAGCTTGTGTCCGCCGTTAGCTTCTGGTCAAAACTCGCCAAAGTCAATTTCCCA
ACTCTACCACAATCTCTTTACTTCGATAATGGAAACAGTAACAACAATGGTAACAGCAACTTGTGTCCCAACGGAAACTG
CACAACACTTGGCATCAACGGCAATCATCTCTATCCTCAAGTGGAGAACGTAAACTTCAACATGGCAACTGAGCTCTGCC
CGAATAATCAAATGAACCCAATTTTTCAAGACGATCACCAGGATGAAACTATGAGTCAATTACCTGGGATGCAAGTTACA
CATCCATCATCTCAGCATATCAACATGGGAAGATACATTATTAGCGGGTCACATTTTAACAATCCGATGATCCCAGACGA
TCGCCACACGAGTAACACAGGTAAGTTACGTGGACCGTATCTACAAGACATCTTAGCTCAAGAAGAAGTGATACAGAACA
TGAAATGCGTACGTCAGTTTCAGACTAACGGAGGATATTGTAATTGTAATCAGTGCTTCAACAACATCAATGGTTCACTG
CCTCCTGATTCGTAG