Details for Chinese cabbage Locus Brara.E03340

Position : A05 ( 5`- 26907472 .. 26908074 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03340

Protein [Map View]
MSGTNPSTWPELEGTETVPFRRRLVTAQRGQRVFAPKLLEALRRSRRSSEAPASHISRRWGGTAAQKVYSLKLYDALQRS
RRSTTVRDTADKVLAATARGTTRWSRAILVSRLGRSLRRHKNTKPASAVRGGGGGRRKLSVVGNRVRVLGGLVPGCRRTA
LPELLDETADYIAALEMQVRAMTALSKILSEFQPSDKLSA*

DNA
ATGTCTGGAACGAATCCATCGACGTGGCCGGAGTTAGAAGGAACTGAAACCGTTCCTTTTCGCCGGAGATTGGTAACGGC
TCAAAGAGGTCAAAGAGTTTTCGCTCCAAAGCTACTGGAGGCTCTTCGTAGATCAAGAAGAAGTTCAGAAGCTCCGGCGA
GCCATATTAGTCGGAGGTGGGGAGGTACGGCGGCGCAGAAGGTTTATTCCTTAAAGCTCTACGACGCTCTCCAGCGATCG
CGGCGGAGCACAACGGTCCGAGACACGGCCGACAAAGTGCTAGCGGCTACAGCTCGTGGTACGACTCGGTGGAGCCGAGC
CATATTGGTCAGTCGACTCGGGAGGAGTCTGCGGCGACACAAGAATACAAAGCCGGCGTCGGCGGTCAGGGGAGGTGGAG
GTGGGAGGAGGAAGTTGTCGGTGGTGGGAAATCGGGTCCGAGTGTTGGGTGGTTTGGTGCCAGGTTGCCGGAGAACGGCG
TTGCCGGAGCTTTTGGACGAGACGGCTGATTACATAGCGGCGTTGGAAATGCAAGTCCGAGCCATGACAGCTCTATCGAA
AATTCTGTCCGAGTTTCAGCCGTCTGATAAACTGAGTGCATGA