Details for Chinese cabbage Locus Brara.E03339

Position : A05 ( 5`- 26899156 .. 26901044 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03339

Protein [Map View]
MSCSDKKTTVDPLLKDLDEKKESFRRNVVSLASELKQVRGRLVSQEQSFLKETQTRKEAEKRAKNMEMEMCKLNKRLEER
NSQLHASASDAEKFIKDLEEFRSQLDATNQTAEASADSAESTKIQCSVLKQQLDDKTRSLREHEHRVTQLGHQLDDLQRG
LSLRECSEKQLREELRRIEREVTEAITKAGIDSNDCVLKKFLEDVSPVNFERMNRLVEVNDVEVKKLKDEIRLMSGHWKH
QTKELESQLEKQRRTDQDLKKKILKLEFCLQETRSQTRKLQRKEERRDMEIKEIRDLMSGKQQGDEESWGKQKFWDNSGF
KIVVSMSMLMLVVVSKR*

DNA
ATGTCTTGTTCCGACAAAAAAACCACGGTGGATCCACTTCTGAAAGATTTGGACGAGAAGAAAGAGAGTTTCCGGAGGAA
CGTCGTCTCTTTGGCGTCTGAGCTGAAGCAAGTCAGGGGCCGTTTGGTTTCTCAAGAACAATCTTTCCTTAAAGAAACCC
AAACTAGAAAAGAAGCAGAGAAGAGAGCAAAGAACATGGAAATGGAGATGTGTAAATTAAATAAGAGATTAGAAGAAAGG
AACTCTCAGCTTCATGCTTCTGCATCTGATGCTGAAAAGTTTATTAAAGACTTGGAGGAATTTCGATCACAGCTGGATGC
AACTAATCAAACCGCAGAGGCAAGTGCTGACTCTGCTGAATCTACAAAGATCCAATGCTCAGTGCTTAAACAACAACTTG
ACGACAAAACACGTTCTCTTAGAGAACACGAGCACCGTGTGACTCAGCTCGGGCACCAGCTTGATGATCTACAGAGAGGT
CTGAGTTTGAGAGAGTGCTCAGAGAAGCAGCTAAGAGAGGAGCTTAGGAGAATTGAGCGCGAGGTTACAGAAGCTATTAC
AAAGGCTGGGATAGATAGCAACGATTGCGTGCTGAAGAAGTTTCTAGAAGATGTCTCTCCTGTGAATTTTGAGAGGATGA
ATAGATTAGTTGAAGTGAATGACGTGGAGGTCAAGAAACTGAAAGATGAGATTAGGTTGATGTCAGGTCATTGGAAGCAT
CAGACTAAGGAACTCGAATCTCAGCTGGAGAAACAGAGAAGAACGGATCAAGACTTGAAGAAGAAGATACTGAAGCTTGA
GTTCTGTCTTCAAGAAACAAGAAGCCAGACCAGAAAGCTACAGAGAAAAGAGGAAAGAAGGGACATGGAGATCAAAGAGA
TAAGAGACCTGATGTCAGGGAAACAACAAGGTGATGAAGAATCTTGGGGGAAACAGAAGTTTTGGGACAATTCAGGATTC
AAGATCGTTGTATCAATGTCTATGTTGATGTTAGTGGTAGTCTCCAAGAGATAG