Details for Chinese cabbage Locus Brara.E03336

Position : A05 ( 5`- 26886831 .. 26887067 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03336

Protein [Map View]
MGGSMSHSLFSFFKTRRSQRVEVDASWDDVVYTRKAMASDEDKRYWVAEPGIDRKASAFIAKFHATRVSASQRQSLSP*

DNA
ATGGGAGGAAGCATGTCACACAGTCTCTTCAGCTTCTTTAAAACACGAAGATCTCAAAGAGTGGAAGTAGACGCCTCTTG
GGATGACGTCGTTTATACTCGCAAAGCAATGGCTAGTGATGAAGACAAACGTTACTGGGTGGCTGAACCAGGTATTGACC
GCAAAGCGTCTGCCTTTATTGCCAAGTTTCATGCCACTCGTGTCTCTGCGTCCCAGCGCCAATCTCTCTCTCCGTAG