Details for Chinese cabbage Locus Brara.E03333

Position : A05 ( 5`- 26842035 .. 26842420 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03333

Protein [Map View]
MHHEVSSWTWNAQDEARGICRMAFHGCCLDYRLPDDECLSEVLFFHVFTLYIIVLSDNNNRWVNALFGVSHGYPRWCHKC
DDGLIT*

DNA
ATGCACCATGAAGTTTCTTCATGGACATGGAATGCTCAAGATGAAGCACGTGGGATATGTCGGATGGCGTTTCATGGTTG
TTGCCTTGATTACAGACTTCCTGACGATGAATGCCTAAGTGAAGTTCTGTTCTTTCACGTCTTCACTTTATATATAATTG
TGCTATCAGATAATAATAACCGGTGGGTGAATGCTTTGTTTGGTGTGTCTCATGGCTATCCCAGATGGTGCCACAAGTGT
GATGATGGTCTTATAACGTGA