Details for Chinese cabbage Locus Brara.E03332

Position : A05 ( 5`- 26841109 .. 26842133 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03332

Protein [Map View]
MGTATFIDILLAILLPPLGVFLRYGCGVEFWICLVLTLLGYLPGILYALYVLTK*

DNA
ATGGGAACAGCTACTTTCATAGATATTCTTCTTGCTATCCTCTTGCCTCCTCTTGGCGTCTTTCTCAGATATGGTTGCGG
GGTTGAGTTTTGGATATGTTTGGTATTGACGCTGCTTGGGTATCTTCCTGGGATCCTCTACGCCCTTTATGTCCTCACCA
AATGA