Details for Chinese cabbage Locus Brara.E03331

Position : A05 ( 5`- 26836288 .. 26838617 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03331

Protein [Map View]
MASDSQTATATTSEKPVENKVDEEAKLMEKEIVLEDKPVSDSSLTVTKEENVSQTPAADVKEVAAVVKEEESTEKVTDEN
GEKKVAEQVEVIEPALVKESVEEVKVEAGDAEKGKDEKGEEKIAGEVELKEPTLVKESVEEVKVEAGDAEKEEGKGKVEN
GEEKVAEQVEDKEPILVKESVEEVKVEAGDAEKEEGKGKDEDGEEKVAEQVELKKPVLVKESVEEVKAEALDVEKAEEKG
TVECVAEEDNKDKEESKVLDVSESAGGKQVDVVQLVREVPEETVEVKVKDVEVLEVKPKPEASEKVEVVKTEETTLETTE
QSKDELVGKLEDTIVVETKDSKDEQTSESGSIINQDSDTAPKKETDGDASSPADVTEKAITEEKHVVEEPSKDEQENVSE
TKDVATKVATEEENIKKDTEDVKSEETLKETEGNKQEESVKEKVPEAVETAPPVVKEIEEPEVTTKEEVVVKQKSSNSIM
SKVKKSLVKAKKAIIGKSPSSKTISTQEAKEDIKAK*

DNA
ATGGCTTCTGATTCTCAGACCGCAACTGCAACTACATCTGAAAAGCCAGTGGAGAACAAGGTGGACGAGGAGGCTAAGTT
GATGGAGAAAGAGATTGTTTTGGAGGATAAACCGGTTTCAGATTCAAGCCTGACTGTTACTAAGGAGGAGAACGTCAGTC
AAACTCCTGCTGCAGACGTAAAGGAGGTTGCAGCAGTTGTGAAAGAAGAGGAATCTACGGAGAAGGTGACAGATGAAAAT
GGTGAGAAGAAGGTAGCTGAACAAGTGGAAGTTATAGAACCAGCTCTTGTGAAAGAGAGTGTTGAAGAAGTTAAGGTTGA
AGCTGGTGATGCAGAGAAAGGAAAAGATGAAAAGGGTGAGGAGAAGATAGCTGGAGAAGTGGAGCTTAAGGAGCCAACCC
TTGTGAAAGAGAGTGTTGAAGAAGTTAAGGTTGAAGCTGGTGATGCAGAGAAAGAAGAAGGGAAAGGAAAAGTTGAAAAT
GGTGAGGAGAAGGTAGCTGAACAAGTGGAAGATAAAGAACCAATCCTTGTGAAAGAGAGTGTTGAAGAAGTTAAGGTTGA
AGCTGGTGATGCAGAGAAAGAGGAAGGGAAAGGAAAAGATGAAGATGGTGAGGAGAAGGTAGCTGAACAAGTGGAGCTTA
AGAAACCAGTACTTGTGAAAGAGAGTGTTGAAGAAGTTAAGGCTGAAGCTCTTGATGTGGAGAAAGCAGAAGAGAAGGGA
ACCGTTGAATGTGTAGCTGAAGAAGACAACAAAGATAAGGAGGAGAGCAAGGTGCTTGATGTTTCTGAATCAGCCGGAGG
CAAACAAGTTGATGTTGTTCAACTTGTTAGAGAAGTACCTGAAGAGACTGTAGAAGTCAAAGTCAAAGACGTTGAGGTTC
TTGAAGTCAAGCCAAAGCCAGAGGCTTCTGAAAAGGTTGAAGTAGTGAAAACCGAGGAAACCACACTTGAAACAACAGAA
CAATCTAAGGATGAGCTTGTGGGAAAGCTGGAGGATACCATTGTTGTTGAGACCAAAGACTCCAAGGATGAACAGACTTC
TGAATCTGGTTCTATTATAAACCAAGATTCAGACACTGCCCCCAAAAAGGAGACAGATGGAGACGCTTCTTCTCCTGCTG
ATGTCACTGAGAAGGCCATCACCGAAGAGAAGCATGTAGTTGAAGAACCATCAAAGGATGAGCAAGAGAACGTAAGTGAA
ACAAAAGATGTCGCCACTAAAGTAGCTACAGAAGAAGAAAACATCAAGAAGGACACTGAAGATGTCAAGAGTGAAGAGAC
TTTGAAAGAAACTGAAGGAAACAAACAAGAGGAATCAGTCAAGGAGAAAGTACCAGAGGCTGTAGAAACAGCACCACCTG
TTGTTAAAGAGATCGAAGAGCCAGAAGTCACAACCAAAGAAGAAGTTGTTGTCAAGCAAAAAAGTTCAAACAGCATCATG
TCAAAGGTGAAGAAGTCTCTTGTTAAGGCAAAGAAAGCAATCATTGGTAAATCTCCAAGCTCTAAGACTATCTCAACTCA
AGAAGCCAAAGAAGACATCAAAGCCAAGTGA