Details for Chinese cabbage Locus Brara.E03329

Position : A05 ( 5`- 26830391 .. 26831337 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03329

Protein [Map View]
MTVKKVEIKVDINCGKCNSAILEAVTEIEGVNHISLDEGKSVLTVVGTMDPVCVASRLRKIKQKPVIISVGPLPKPPEPP
KPPVVPEPPKPPPPAPEPPKHVCKCKPMSPYPPPYCARCDLVSVTTYESGSGCTIV*

DNA
ATGACTGTTAAGAAAGTTGAGATCAAGGTGGATATAAACTGTGGTAAATGCAATAGCGCAATTTTGGAAGCAGTCACGGA
GATAGAAGGTGTGAATCATATTTCACTAGATGAGGGGAAGAGCGTACTCACCGTGGTGGGGACAATGGATCCGGTCTGCG
TTGCATCACGTCTTAGGAAGATTAAACAGAAACCTGTAATCATCAGCGTCGGACCACTACCTAAACCTCCTGAACCGCCA
AAGCCTCCAGTAGTGCCTGAGCCACCAAAGCCTCCTCCACCAGCACCTGAACCACCAAAGCATGTATGCAAATGCAAGCC
TATGTCTCCTTACCCACCTCCTTACTGCGCCAGATGCGATCTTGTGTCTGTTACTACCTATGAAAGTGGAAGCGGCTGCA
CCATTGTTTGA