Details for Chinese cabbage Locus Brara.E03327

Position : A05 ( 5`- 26827291 .. 26828156 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03327

Protein [Map View]
MSRNVSVWQSNNGYYGYGYGGGYMEKRQLFLKSYQFSRKQILTEKIKRSMRRVVKKVVWMRLKSARRMKRVVWSRLKMAF
FYRRRHFFRLLHPNKPSSYYCFY*

DNA
ATGAGCAGAAACGTCAGCGTTTGGCAGAGCAATAACGGCTACTATGGATATGGCTATGGAGGAGGATACATGGAGAAGAG
ACAGCTGTTCCTCAAGAGCTACCAGTTCTCTAGAAAACAAATCTTAACGGAGAAGATTAAGAGGTCTATGAGGAGAGTGG
TGAAGAAAGTTGTCTGGATGAGGTTGAAATCCGCTCGGAGGATGAAACGCGTCGTTTGGTCGCGTCTCAAAATGGCGTTC
TTCTACCGCCGTAGACACTTCTTTCGTCTCCTTCACCCGAACAAACCCTCCTCTTATTACTGCTTCTACTAA