Details for Chinese cabbage Locus Brara.E03324

Position : A05 ( 5`- 26817315 .. 26819636 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03324

Protein [Map View]
MAVVVSSNGNAPAFEAKLTVYVFICVVIAAFGGLIFGYDIGISGGVTAMDDFLKEFFPAVWERKKHAHENNYCKYDNQFL
QLFTSSLYLAALVASFFASAVCSKLGRKPTMQFASIFFLIGVGLTAGAVNLIMLIFGRILLGFGVGFGNQAVPLFLSEIA
PAQLRGGLNIVFQLMVTIGILIANLVNYFTAKVHPYGWRIALGGAAIPAVFLLFGSLIICETPTSLIERNKNEEGKEALR
KIRGVEDINEEYESIVHACDIASQVKDPFRKLLKPASRPPFIIGMLLQLFQQFTGINAIMFYAPVLFQTVGFGSEAALLS
AVITGTINVLSTFVGIYLVDKTGRRFLLLQSSVHMLICQLIIGIILAKDLGTTGTLGKPQALVVVIFVCVYVMGFAWSWG
PLGWLIPSETFPLETRSAGFAVAVSCNMFFTFVIAQAFLSMLCGMRSGIFFFFSAWIVVMGLFAMFFIPETKGVAIDDMR
ESVWKPHWFWKRYMLDEDDVEKRN*

DNA
ATGGCTGTTGTTGTATCATCTAACGGGAACGCTCCTGCTTTCGAAGCCAAGTTGACTGTCTATGTCTTTATCTGCGTTGT
CATTGCTGCTTTCGGCGGTTTGATCTTCGGTTACGACATCGGAATTTCCGGTGGAGTGACGGCTATGGACGATTTCTTGA
AAGAATTTTTCCCTGCTGTGTGGGAGAGGAAGAAGCACGCACATGAGAATAATTACTGCAAGTATGATAACCAGTTCTTG
CAGCTGTTCACATCTTCTCTTTACCTAGCCGCGCTCGTTGCCAGCTTCTTCGCTTCAGCCGTTTGTTCTAAACTCGGAAG
GAAGCCCACGATGCAGTTCGCTTCTATCTTCTTCTTGATCGGTGTGGGACTAACCGCGGGAGCGGTTAACCTCATCATGT
TGATTTTTGGAAGAATCTTGCTTGGCTTTGGTGTTGGCTTTGGCAACCAGGCAGTGCCGCTTTTCTTGTCGGAGATTGCT
CCAGCACAGCTCAGGGGAGGTCTCAACATTGTGTTCCAACTCATGGTCACAATAGGAATCCTAATAGCCAACCTTGTCAA
TTACTTCACTGCCAAGGTACATCCTTACGGTTGGCGTATTGCTCTCGGTGGAGCCGCGATTCCCGCCGTTTTCCTTCTCT
TCGGTTCACTGATCATCTGCGAGACTCCCACGAGCCTCATCGAGCGCAACAAGAACGAAGAAGGCAAAGAAGCACTAAGG
AAGATCAGAGGAGTTGAAGATATCAATGAAGAGTATGAATCTATCGTCCATGCTTGTGACATTGCGAGTCAGGTCAAGGA
CCCTTTCAGGAAACTGTTGAAGCCAGCGAGTCGCCCACCGTTCATCATCGGAATGCTTCTCCAGCTTTTCCAGCAGTTTA
CTGGAATCAATGCTATTATGTTCTATGCACCGGTTCTGTTCCAGACCGTTGGTTTTGGAAGCGAAGCAGCTCTTCTCTCC
GCGGTTATCACGGGAACTATCAACGTTCTCAGTACGTTCGTCGGGATCTACCTCGTGGACAAAACTGGTCGGAGATTCCT
TCTTCTACAATCTTCTGTTCACATGCTAATTTGCCAGTTGATCATTGGAATCATCCTAGCGAAAGACTTAGGCACGACGG
GGACACTCGGGAAGCCACAAGCGCTAGTGGTTGTGATCTTTGTGTGCGTTTACGTGATGGGATTCGCGTGGTCATGGGGA
CCTTTAGGATGGCTGATTCCTAGCGAGACTTTCCCACTAGAGACACGAAGTGCAGGGTTCGCCGTTGCTGTCTCGTGCAA
CATGTTCTTCACGTTCGTGATCGCGCAGGCTTTCTTGTCGATGCTTTGCGGGATGAGATCGGGGATATTCTTCTTCTTCA
GTGCTTGGATCGTTGTGATGGGACTGTTTGCGATGTTCTTCATACCGGAGACTAAAGGAGTGGCTATTGATGATATGAGG
GAGAGTGTGTGGAAGCCTCATTGGTTCTGGAAAAGGTATATGCTTGATGAGGATGATGTGGAGAAGAGAAACTGA