Details for Chinese cabbage Locus Brara.E03322

Position : A05 ( 5`- 26808828 .. 26809400 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03322

Protein [Map View]
MTKRRICYIVSGIISILFITFMTILILSQTVFKPKHPVLQTLSSTVEGVSTHISPPLDVQINFTLTLQMLLKNPNLVDFE
YKTVENLVYYRDILVGNLTLPSSTLPAKGSAILPCPLVLQIDKFVANLGDILQDILQRKIVIETKANMPGKITVLGIFKA
HLNTTSHCKLVLSVPSMEVVDQVCDLEAKL*

DNA
ATGACCAAACGACGTATTTGTTACATAGTTTCTGGAATCATTTCCATCCTTTTTATCACCTTTATGACCATTTTGATCCT
TTCGCAGACCGTGTTCAAACCAAAACATCCTGTATTACAAACCTTGTCTTCGACTGTTGAAGGTGTATCCACACATATAT
CACCGCCACTTGACGTCCAGATCAATTTCACACTTACACTCCAAATGCTGTTGAAGAATCCTAATCTTGTCGATTTCGAA
TACAAGACAGTAGAAAACTTGGTTTATTATAGGGATATTCTGGTGGGAAATCTCACTCTTCCTTCGAGCACACTTCCCGC
CAAAGGCTCCGCGATTTTGCCATGTCCTCTTGTTCTTCAGATCGATAAATTTGTTGCCAATTTAGGTGATATTTTGCAAG
ATATATTGCAAAGAAAAATTGTGATAGAAACAAAGGCAAATATGCCAGGGAAAATTACAGTGTTGGGAATCTTTAAGGCA
CACTTGAACACAACATCACATTGCAAACTCGTACTTAGCGTTCCTTCAATGGAAGTGGTGGATCAAGTGTGTGATCTTGA
AGCTAAACTATAA