Details for Chinese cabbage Locus Brara.E03313

Position : A05 ( 5`- 26767490 .. 26768941 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03313

Protein [Map View]
MAMSILKLRNSPALRSAASSARIGVLSRAFSKLSEGTDITSAAPGVSLQKARSWDEGVSSKFSTTPLSDIFKGKKVVIFG
LPGAYTGVCSQQHVPSYKSHMDKFKAKGIDSVICVSVNDPYTINGWAEKIGAKDAIEFYGDFDGKFHKSLGLDKDLSAAL
LGPRSERWSAYVEDGKVKAVNVEEAPSDFKVTGAEVILGQI*

DNA
ATGGCGATGTCTATTCTGAAGCTAAGAAACTCACCGGCTTTGAGATCCGCCGCAAGTAGTGCCCGGATCGGAGTTTTATC
AAGGGCTTTCTCAAAGCTCTCGGAGGGCACGGACATAACCTCGGCTGCGCCAGGCGTTTCACTCCAGAAAGCTCGCAGCT
GGGACGAAGGCGTTTCCTCCAAATTCTCCACCACACCATTGTCAGACATCTTCAAGGGGAAGAAAGTCGTCATCTTTGGA
CTTCCTGGAGCTTACACTGGAGTCTGCTCACAGCAGCATGTGCCAAGCTACAAGAGCCACATGGATAAGTTCAAAGCCAA
AGGCATTGACTCCGTCATCTGTGTCTCTGTGAATGATCCGTATACAATAAATGGTTGGGCAGAGAAGATTGGTGCCAAAG
ATGCTATTGAGTTTTATGGAGATTTTGATGGGAAATTCCATAAAAGCTTGGGGCTAGACAAGGATCTCTCTGCTGCATTG
CTCGGCCCTCGGTCTGAGAGATGGTCGGCTTATGTAGAAGACGGTAAGGTGAAGGCTGTGAACGTGGAAGAAGCACCGTC
TGACTTCAAGGTGACGGGAGCAGAAGTCATTTTAGGACAGATCTAA