Details for Chinese cabbage Locus Brara.E03312

Position : A05 ( 5`- 26765178 .. 26767207 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03312

Protein [Map View]
MSPSFLLLLIPIIPLSFLAILSLIVRPKPIRIPIKSRHVFITGGSSGIGLALAHRAASEGARVSILARSPQKLEEAKQSI
KLATGVEVAIFSADVRDYDAVSKAVEESGPIDVLIVNQGVFTARELEKHSVEDVRFTIEVNLVGSFNVIKAALPRMKGRE
GRGPGSISLVSSQAGQVGVYGYAAYSASKFGLQGLAQSLQQEVVADDIHVTLVFPPDTDTPGFEEEQKSRPEVTAIIAAS
SGSMKTEEVARRAMNGIKAGKFTVSCNFEGFLLSLATTGMSPQRSFWLAFLEVITAGPIRLVALFFQWDWYNAIEKWSKT
KNK*

DNA
ATGTCTCCTTCCTTCCTCCTCCTCCTCATCCCCATCATCCCACTCTCGTTTCTCGCGATCTTATCCCTAATCGTCCGCCC
CAAACCCATCAGAATCCCCATCAAGTCCCGCCACGTCTTCATCACCGGCGGATCCAGCGGCATCGGCCTCGCACTAGCCC
ACCGCGCGGCCTCGGAAGGCGCTCGCGTCTCCATCCTCGCTCGATCCCCCCAAAAGCTCGAAGAAGCGAAACAATCCATA
AAACTCGCCACCGGAGTCGAAGTCGCAATTTTCTCCGCCGACGTCCGCGATTACGACGCCGTTTCGAAGGCTGTTGAGGA
ATCGGGCCCGATCGATGTGTTGATCGTGAATCAAGGCGTGTTCACGGCGAGGGAGCTCGAGAAGCATAGCGTGGAGGATG
TGAGGTTTACGATTGAGGTTAATCTCGTTGGGAGCTTTAATGTGATTAAGGCTGCTTTGCCGAGGATGAAGGGGAGGGAA
GGTCGTGGGCCGGGTTCGATCTCTCTAGTCTCATCTCAGGCTGGTCAGGTGGGTGTTTATGGATATGCTGCTTATTCAGC
GAGTAAGTTTGGGCTACAAGGTTTAGCGCAGTCACTGCAGCAAGAAGTTGTTGCTGATGATATTCATGTCACTCTTGTTT
TTCCTCCTGATACTGATACACCAGGGTTTGAGGAAGAACAGAAGAGTAGACCTGAGGTGACTGCCATAATAGCTGCGTCC
TCTGGTTCAATGAAAACAGAAGAAGTGGCGAGAAGAGCTATGAATGGCATCAAAGCAGGAAAGTTCACTGTCTCATGCAA
CTTTGAAGGATTCTTACTATCACTCGCCACAACCGGAATGTCACCACAAAGATCATTTTGGCTAGCTTTTCTTGAAGTTA
TAACCGCAGGGCCTATAAGGTTGGTCGCTCTCTTTTTCCAATGGGACTGGTACAATGCCATCGAAAAGTGGAGCAAAACC
AAAAACAAATAA