Details for Chinese cabbage Locus Brara.E03311

Position : A05 ( 5`- 26763154 .. 26763979 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03311

Protein [Map View]
MAMEVAMDLELDDDVFYADISKQINLLITDEDEQNPISLSSPISFEGLFRENYQASATPYMMYQEQNYNQVRESKGTGVF
IPRCSQPRRRQHNHPHQKKQGRFGSITPKQQYPHHVYDNNSTTFNNQESITLHHAASINQRRTYRDAASVFT*

DNA
ATGGCCATGGAAGTGGCGATGGACCTTGAGCTTGATGATGATGTCTTCTATGCAGACATAAGCAAGCAAATCAATCTCTT
AATCACAGATGAAGATGAACAGAACCCTATCTCACTTTCCTCTCCTATCTCATTCGAGGGTTTGTTCAGAGAAAACTACC
AAGCATCAGCAACACCATATATGATGTACCAGGAGCAGAATTACAACCAAGTTAGAGAGAGCAAAGGGACAGGAGTGTTC
ATCCCAAGATGTTCTCAGCCAAGAAGGAGACAGCATAATCATCCTCATCAGAAGAAGCAAGGGAGATTCGGTTCCATCAC
CCCCAAGCAACAGTATCCTCATCATGTTTATGACAACAACTCCACAACTTTCAACAACCAAGAAAGCATCACCCTACATC
ATGCAGCTTCTATTAACCAAAGAAGAACCTACAGAGATGCAGCATCTGTCTTCACTTAA