Details for Chinese cabbage Locus Brara.E03306

Position : A05 ( 5`- 26731483 .. 26733608 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03306

Protein [Map View]
MSCLACCCASATCGLCSSVASGISRKSARIAYCGLFGASLVVSWILRETAAPLLEKFSWINTSDSYTKEWYQQQAVLRVS
FGNFLFFAIYALVMIGVKDQNDRRDSWHHGGWPVKMIVWFLLVVLMFFVPNEIISIYGILSKFGAGAFLLVQVVLLLDAT
HNWNDSWVEKDERKWYVALLVISIVCYIATYAFSGVLFMWFNPSGHDCGLNVFFIVMTMILAFVFAIVALHPAVNGSLLP
ASVISVYCAYVCYTGLSSEPHDYVCNGLNRSKAVTASTLILGMLTTVLSVLYSALRAGSSTTFLSPPSSPRAGGKEALLE
DPEDGKKNGEAEARPVSYSYSFFHIIFALASMYAAMLLSGWTDSSESASLIDVGWTSVWVKICTGWVTAALYIWTLIAPL
ILPDREFY*

DNA
ATGTCGTGCTTAGCTTGTTGCTGTGCGTCGGCGACGTGTGGGCTGTGCTCGTCGGTGGCTTCCGGGATCTCGAGGAAATC
GGCGAGGATCGCTTATTGTGGCCTCTTCGGTGCCTCCCTTGTCGTCTCTTGGATCCTCCGCGAGACCGCCGCTCCGCTCC
TCGAGAAATTCTCTTGGATAAACACTTCGGATTCATATACTAAAGAATGGTATCAGCAGCAAGCTGTTCTTCGTGTGAGC
TTTGGGAACTTCCTCTTCTTTGCCATTTACGCTTTGGTCATGATTGGTGTGAAAGACCAGAACGATAGGCGTGACTCGTG
GCACCACGGTGGATGGCCTGTGAAGATGATTGTTTGGTTTCTGCTTGTTGTCCTTATGTTCTTTGTTCCAAATGAAATCA
TCTCAATCTATGGAATCTTATCAAAGTTTGGTGCTGGAGCATTTCTGTTGGTTCAAGTGGTCTTGTTGTTAGACGCTACA
CATAACTGGAATGATTCTTGGGTCGAGAAGGATGAAAGGAAGTGGTATGTCGCTCTGCTTGTCATATCTATCGTGTGTTA
CATTGCCACATACGCCTTCTCAGGAGTCCTGTTTATGTGGTTCAACCCGTCTGGTCATGACTGTGGACTAAATGTTTTCT
TCATCGTCATGACGATGATCCTTGCCTTTGTTTTCGCCATCGTTGCCTTACATCCTGCGGTGAATGGCAGCCTTTTACCG
GCATCGGTTATATCCGTTTACTGTGCGTACGTCTGTTACACGGGTCTCTCTAGCGAACCACACGATTACGTGTGCAATGG
ACTCAACAGATCTAAGGCAGTGACCGCTAGTACGTTAATTCTCGGAATGCTCACTACAGTTCTCTCGGTTCTCTACTCTG
CCCTCAGAGCTGGCTCTTCTACTACATTCCTCTCACCACCATCATCTCCCAGAGCAGGTGGGAAGGAGGCATTGTTAGAA
GACCCTGAGGATGGGAAGAAGAACGGTGAAGCAGAGGCACGGCCTGTGAGTTACTCATACTCTTTCTTCCATATAATCTT
TGCGCTGGCGAGCATGTACGCGGCAATGCTTCTCTCGGGATGGACTGACTCTTCAGAGAGTGCGTCTCTGATCGACGTGG
GATGGACCTCTGTTTGGGTCAAGATTTGCACCGGTTGGGTCACGGCTGCACTCTACATCTGGACACTCATCGCACCGCTC
ATCCTTCCGGATCGTGAGTTTTACTAA