Details for Chinese cabbage Locus Brara.E03305

Position : A05 ( 5`- 26728979 .. 26731342 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03305

Protein [Map View]
MDAIRVCAEVPGSSKPTLTESTSRTETINGSHEFKISGYSLAKGMGIGKYVASDTFTVGGFSWAVYFYPDGKSPEDNSLY
VSLFIALASEGADVRALFELTLVDQSGNERHKVHSHFGRTLESGPYTLKYRGSMWGYKRFFKRTLLEESDYLKDDCLLVR
CCVGVVKSSTEGPRSYNIPVPGSDLGYQFGKVLESGRGADVALLVDGETFLAHRVVLAARSPVFRAQLFGPLRNKNTKRI
NIEDIEAPIFKMFLHFIYWDELPDMEDLMGTDLKWASTLVAQHLLAAADRYALERLRTICESKLCEGISINTVATTLALA
EQHHCFQLKAACLKFIALPANLKAVMETDGFDYLKESCPGLLSELLEYVARLSEHSLASSWNRKEFYPDGCDVNGRRVKQ
RLH*

DNA
ATGGACGCGATTAGGGTTTGCGCGGAGGTTCCCGGATCTTCGAAACCGACCCTCACGGAATCAACCTCTCGCACGGAGAC
CATCAACGGCTCCCACGAATTCAAAATCAGCGGATACTCTCTCGCCAAAGGGATGGGGATAGGCAAATACGTGGCCTCTG
ACACCTTCACGGTCGGTGGATTCTCCTGGGCGGTTTACTTCTACCCAGACGGGAAGAGTCCAGAGGATAACTCTCTCTAC
GTGTCTCTCTTTATAGCTCTCGCGAGCGAAGGTGCTGACGTTAGAGCTTTGTTTGAGCTGACGCTCGTTGACCAGAGCGG
TAACGAGAGGCATAAAGTGCATAGCCATTTCGGTAGGACTCTCGAGAGTGGGCCTTATACGCTTAAGTACAGAGGGAGTA
TGTGGGGATATAAACGGTTTTTTAAGAGGACTTTGCTTGAGGAGTCGGATTATTTGAAGGATGATTGTCTTTTGGTAAGG
TGTTGTGTTGGCGTGGTGAAGTCGAGCACTGAAGGGCCGAGGAGTTATAATATTCCTGTTCCGGGGTCTGACTTGGGTTA
TCAGTTTGGGAAGGTTTTGGAGAGTGGGAGAGGAGCTGATGTTGCTCTCCTTGTTGATGGAGAGACGTTTCTTGCTCACA
GAGTGGTTCTTGCAGCTCGGTCTCCTGTCTTCAGGGCGCAGCTTTTTGGACCGTTGAGAAACAAAAATACGAAACGCATT
AACATAGAAGACATTGAAGCTCCTATTTTCAAGATGTTCCTCCATTTTATCTACTGGGACGAATTGCCTGATATGGAAGA
CTTAATGGGCACAGACTTGAAATGGGCGTCGACTCTCGTGGCTCAGCATCTGCTTGCGGCTGCAGACCGTTACGCTCTCG
AGCGGCTTAGAACAATCTGCGAGTCAAAACTCTGCGAAGGAATCAGCATAAACACGGTTGCAACCACATTGGCTTTGGCA
GAGCAGCATCATTGTTTCCAGCTGAAAGCTGCATGCCTCAAATTCATAGCTCTGCCAGCAAATCTGAAAGCTGTGATGGA
AACGGATGGGTTTGATTATCTGAAGGAAAGCTGCCCGGGCTTACTAAGTGAGCTTCTGGAGTATGTGGCTAGGCTGAGTG
AGCATTCTTTAGCATCGTCATGGAATCGGAAAGAGTTTTATCCTGATGGTTGTGACGTGAATGGGAGACGCGTCAAGCAG
CGGTTACACTGA