Details for Chinese cabbage Locus Brara.E03294

Position : A05 ( 5`- 26670294 .. 26674073 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03294

Protein [Map View]
MNKTSVELFQMYDDHRNRGITIPTEKEFRGYYALLKLDKHPGYKVEPSELSLDLANMTPEIRQTSEVLFARSVARACRTG
NFIAFFRLARKASYLQACLMHAHFSKLRTQALASLHAGLQNNQGLPVSDTSKWIGMEEEDIEALLEYHGFSIKEFEEPYM
VKDDLFLHADKDYKTKCSKLVHMKKSRTIVEDVSAPSIEEDVPASSPLSSLSIEANKGYQQETPPPQSLKKQTSLRLVDK
EMADSKTSLLLEEDKPVKTSVINPVRPSDVKPAVDQQKGNHFTPAGEFHSPPKFYSPGFPQAESLNLKKQPNDGHTSISP
AEINFPFAEHMQTNLVPVPTLQQSPKSMPMENVSVATKIESPRSVENIFALEESVPEAAMTVTLEEGFHDIEQEDEDGHE
DITSQYDEEVAKAKLKLIIRLWKRWSSRQSELRERRQLAAAAALNSLTLGTPIRLSKTDQSRACGEFDIDQAMKRRFEER
EKSWSKLNISDVIADILVERNPDSKCIWWKVILCTQIKSVDSSSQDTHAAASRWLSSKLIPDTEHTISDANLLFAAPGVS
VWNKWVASGSDSDSRCCLSVARDVESDNDPRGASAVLFLASKGIPLNLQREHLNRILESVPNGSLLPLLVLTSSSNGESV
DPDTNLASELGLHDIDKSKIASFTVVSIANNSQKGHEVRFFSDSRLRDGLKWLASNSPPQPNLQHVKPRELVLTHLSFSL
ELLKQMRDQEVGPNICISAFNDALETSKRNIASAAEANPICWPGPETMLLEDNRKEHLMAKRYLPNVDWSSAESIEPLNS
VLENCKLPCFEDDLTWLTLGCASGAEIENHTQRLEGCVVEYLTQTSNLMGDSLASKEARVMLQRNATLELHNSSYYHVIP
RWIGIFQRIFNWRIMGVLDSSSSSAYVLKSDLTMSASSYAVKFLSEDSFSRPNLPLLHEMVLISCTPLKSSPKVESVQTE
RLVDDHRDIDESMLEKSREASRRIDMMITEDDELAVKRKKAAEKKTVKDRDSERLNELLEKCNLVQNSIAEKLCIYF*

DNA
ATGAACAAGACATCTGTTGAGTTGTTTCAAATGTATGATGATCATCGGAATAGAGGAATAACTATTCCTACAGAAAAAGA
GTTCCGTGGCTATTATGCTCTTCTTAAACTCGACAAGCACCCTGGCTATAAGGTTGAACCGTCTGAGCTTTCCCTTGATC
TTGCCAACATGACTCCAGAAATAAGGCAAACTTCAGAAGTTCTCTTTGCCCGCAGTGTAGCCAGAGCTTGTAGAACTGGC
AACTTCATTGCCTTCTTTCGCCTAGCAAGAAAAGCAAGTTATCTTCAAGCATGTCTAATGCACGCTCATTTTTCTAAGCT
AAGAACTCAGGCACTTGCTTCTCTACACGCGGGTCTCCAAAATAATCAGGGTCTCCCAGTTTCAGATACGTCAAAGTGGA
TAGGGATGGAGGAAGAGGACATAGAAGCCCTGTTAGAGTACCATGGATTTTCGATAAAAGAGTTTGAAGAGCCATACATG
GTAAAGGATGACCTGTTTCTCCATGCTGATAAGGACTACAAAACAAAATGCTCAAAACTTGTTCACATGAAAAAGTCAAG
AACCATTGTGGAAGATGTTTCTGCTCCATCGATAGAAGAAGATGTTCCTGCTTCCTCTCCGTTGTCATCCTTGTCGATAG
AAGCAAATAAAGGATATCAACAGGAAACACCGCCTCCTCAAAGTCTTAAGAAACAAACATCACTGCGTCTAGTTGATAAA
GAAATGGCCGATTCCAAGACTTCCCTCTTACTGGAGGAAGACAAGCCAGTGAAGACATCTGTTATAAATCCAGTGCGGCC
ATCTGATGTAAAACCAGCAGTGGATCAACAGAAAGGAAATCACTTTACGCCGGCTGGTGAATTTCATTCTCCCCCGAAGT
TCTATTCTCCTGGATTTCCTCAAGCTGAATCCTTGAATTTGAAGAAACAACCTAATGACGGCCACACTAGTATATCTCCT
GCAGAAATTAATTTTCCATTTGCAGAGCATATGCAAACGAATCTTGTGCCTGTACCTACTTTGCAACAAAGTCCGAAGTC
TATGCCTATGGAGAATGTGTCTGTAGCTACCAAAATAGAGTCTCCAAGGAGTGTAGAAAACATATTCGCTTTGGAAGAAT
CAGTACCTGAAGCTGCGATGACTGTTACCTTGGAAGAGGGTTTCCATGACATTGAACAGGAAGACGAGGATGGACATGAG
GACATCACAAGTCAGTATGACGAGGAAGTGGCGAAGGCCAAGCTCAAGTTGATCATAAGATTATGGAAGCGGTGGTCTTC
ACGTCAAAGTGAATTGCGGGAGCGTCGACAGTTAGCTGCAGCTGCTGCACTGAATTCTCTAACCCTGGGCACTCCTATCA
GACTCAGCAAAACTGATCAATCGAGAGCGTGTGGTGAGTTTGACATTGATCAAGCGATGAAGAGGAGATTTGAAGAACGG
GAAAAATCATGGTCAAAACTGAATATTTCAGATGTGATAGCTGATATATTAGTCGAAAGGAATCCAGACTCAAAATGCAT
ATGGTGGAAGGTCATCCTATGTACTCAGATTAAATCAGTTGACTCATCAAGTCAGGATACACATGCAGCAGCCAGTAGAT
GGTTATCATCAAAGCTTATCCCTGACACAGAACATACCATCTCCGATGCTAATCTGCTGTTTGCAGCTCCCGGTGTGTCG
GTATGGAATAAATGGGTTGCAAGTGGGTCTGATTCAGATTCCAGATGCTGTCTCTCAGTAGCTAGGGATGTGGAATCTGA
TAATGATCCACGTGGTGCAAGCGCAGTTCTCTTCCTTGCATCTAAAGGCATCCCTTTGAATCTCCAGAGAGAACATCTTA
ACCGCATTCTTGAATCAGTACCCAACGGTTCACTCCTTCCCCTTCTCGTTCTAACCAGCTCAAGCAATGGAGAAAGCGTG
GATCCCGATACAAATCTCGCCTCCGAGCTAGGCCTCCATGATATCGACAAATCAAAGATAGCAAGCTTCACCGTCGTTTC
TATCGCTAATAACTCCCAGAAGGGACATGAAGTTCGTTTTTTCAGCGATTCACGGCTAAGGGACGGACTCAAATGGCTTG
CGAGTAATTCACCTCCGCAACCAAATCTTCAGCACGTTAAACCGCGGGAACTTGTTCTGACGCATTTAAGTTTTTCTCTA
GAGTTGCTTAAGCAGATGCGAGATCAGGAAGTTGGTCCTAACATCTGCATATCAGCCTTCAACGACGCATTGGAAACATC
TAAAAGAAACATCGCTTCTGCTGCTGAAGCGAATCCGATCTGTTGGCCTGGCCCTGAGACAATGTTGCTCGAGGATAATA
GAAAAGAACATTTAATGGCGAAGAGGTATCTACCCAACGTGGACTGGAGCAGTGCAGAGAGCATCGAACCACTCAACTCG
GTCCTCGAGAACTGTAAGCTTCCTTGTTTTGAAGATGACTTGACATGGTTAACACTAGGATGTGCTTCTGGTGCTGAGAT
AGAGAACCATACGCAACGGCTCGAGGGATGCGTAGTTGAGTACTTGACACAGACGAGCAATCTCATGGGAGACTCATTAG
CCAGCAAAGAAGCAAGAGTAATGCTACAGAGAAACGCTACCCTCGAACTCCATAACTCAAGCTACTACCATGTTATTCCG
AGATGGATCGGGATCTTCCAGAGGATCTTCAACTGGCGGATAATGGGTGTGCTAGATTCGTCGTCTTCCTCAGCTTACGT
ACTGAAGTCAGATCTCACCATGTCAGCTTCAAGCTATGCTGTTAAGTTCTTGTCTGAAGATTCATTTTCTCGTCCAAATC
TTCCATTGCTCCACGAAATGGTCCTAATCAGCTGCACCCCCTTGAAGTCGTCTCCTAAAGTAGAATCTGTTCAGACAGAG
AGGCTTGTTGATGATCACAGAGACATAGATGAGTCAATGTTGGAGAAGAGTAGAGAAGCTTCGAGAAGGATTGATATGAT
GATAACCGAGGATGATGAGTTAGCTGTTAAAAGAAAAAAAGCTGCGGAGAAGAAAACGGTGAAGGATAGAGATAGCGAGA
GATTAAATGAACTGTTGGAGAAATGTAACTTGGTACAGAACAGCATAGCAGAGAAGCTCTGCATTTACTTTTGA