Details for Chinese cabbage Locus Brara.E03293

Position : A05 ( 5`- 26652207 .. 26654327 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03293

Protein [Map View]
MSMSRRGLIRMLLVAVFLVVLQSSTALISSPSSIINPSKVKQVSSKPRAFVYEGFLTDLECDHLISLARENLQRSAVADN
DNGDSQVSDVRTSSGTFISKGKDPIVSGIEDKLSTWTFLPKENGEDLQVLRYEHGQKYDAHFDYFHDKVNIARGGHRIAT
VLMYLSNVTKGGETVFPDAVESSRRQLSVNKDDLSDCAKKGIAVKPKKGDALLFFNLHQDATPDTLSLHGGCPVIEGEKW
SATKWIHVDSFDKIVTHDGSCADVNESCERWAVLGECAKNPEYMVGTPELPGNCRRSCKAC*

DNA
ATGTCAATGTCTCGCCGCGGATTGATTAGGATGTTGCTCGTCGCCGTCTTCCTTGTCGTGCTTCAGTCATCAACTGCTCT
GATTAGTTCTCCGAGTTCTATCATCAACCCTTCTAAAGTCAAACAAGTTTCTTCAAAACCCAGGGCATTTGTGTATGAAG
GTTTTCTAACGGACCTGGAATGTGATCATCTGATCTCCCTTGCGAGAGAGAATCTGCAGAGATCTGCGGTTGCTGATAAC
GACAATGGGGACAGTCAAGTCAGTGACGTTCGGACCAGCTCCGGCACGTTTATCTCCAAAGGAAAGGATCCTATTGTTTC
CGGTATAGAGGACAAGCTCTCCACATGGACATTCCTTCCAAAAGAAAATGGAGAAGACCTTCAGGTATTGAGATATGAGC
ACGGTCAAAAATACGACGCTCACTTTGACTACTTCCACGACAAAGTCAACATCGCCCGCGGTGGACACCGCATAGCAACC
GTCCTCATGTATCTCTCCAATGTCACAAAGGGTGGAGAAACTGTTTTCCCTGATGCAGTGGAGTCTTCCCGCCGCCAGCT
TTCAGTAAACAAAGACGACCTTTCTGATTGCGCAAAGAAAGGAATTGCTGTGAAACCGAAGAAAGGAGATGCACTGCTGT
TCTTCAACCTCCACCAAGACGCAACCCCAGATACATTGAGCCTTCACGGAGGCTGTCCTGTGATCGAAGGTGAGAAATGG
TCAGCGACCAAGTGGATCCACGTGGACTCGTTCGATAAGATTGTGACGCATGACGGTAGCTGTGCGGATGTAAACGAGAG
CTGTGAGAGATGGGCGGTGCTTGGAGAGTGCGCAAAGAACCCAGAGTATATGGTGGGAACTCCAGAGCTCCCTGGAAACT
GCAGGCGTAGCTGTAAAGCTTGTTAA