Details for Chinese cabbage Locus Brara.E03290

Position : A05 ( 5`- 26637381 .. 26640494 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03290

Protein [Map View]
MNINRDEALRAQALAEALMQKSDFTAARKLAIKAHSMDSTLENISHMTMVCDVHCAAAEKTFGNNEMDWYGILQVDVNAN
EAVIKKQYRKLALLLHPDKNKLPGAESAFKLIGEAQRILLDKDMRMLHDVKRRTRPAPAPRVPSYRAQQASVNMRNVFNG
VRPQGQPPHGFAPRPTFWTSCPFCGSRYEYGREHVKREVACQTCKKLFTAFEVSFPTQQNMFPGQRACAEPHKRPVDTKN
VPSGKKATAASTAENNNEKRKRKRKDTDEPSESSESESSSDSEDDSNNVPPGKKATASTVENNNGKRKRKDIDECSESSD
SESSSDSEDDDTMAAGNNMGSNGGQEPRRSVRSKRQVSYNENVSDDDDVDLVNDVGEGENVDTEKVDEDHHHQSTEALNP
KEKIQVSLDDSEDEESSLGGEAAAEEEANVINCEDPEFSDFDKLREKSCFSERQVWALYDEGEGMPRFYAVIKKVTKPRF
SVKYVWLEPDETRDLPVSVGRYVLGDEGKTSSCDLFSHLVQSKTRSNAKNFTVFPGKGETWALFKNWDMEEEEDSDSPRE
YEFVEILSDHEEGGGTVSVGFLSKVEGFKYVYSPLPEEEADTFEIPPHELFRFSHRVPSFRLKGTEGRGVLEGWFELDPA
ALPVPVSQDQDHHQSPPP*

DNA
ATGAATATTAATAGAGATGAGGCTCTTAGAGCCCAAGCTTTAGCAGAAGCCTTAATGCAAAAGTCTGACTTCACCGCCGC
TCGTAAGCTCGCCATCAAAGCTCACAGCATGGACTCCACTCTTGAGAACATATCTCACATGACGATGGTCTGCGACGTGC
ACTGCGCCGCGGCGGAGAAGACGTTTGGAAACAACGAGATGGACTGGTACGGGATACTCCAGGTCGACGTGAACGCTAAC
GAAGCCGTCATCAAGAAACAGTACAGGAAGCTCGCGCTTCTTCTCCACCCTGATAAAAACAAGCTCCCTGGCGCCGAGTC
CGCTTTTAAACTCATCGGTGAAGCTCAGAGGATACTTTTGGATAAAGACATGAGGATGCTTCATGATGTTAAACGCAGAA
CGAGGCCTGCACCTGCGCCACGTGTGCCTAGTTATCGCGCGCAGCAGGCAAGTGTTAATATGAGGAATGTCTTCAATGGG
GTGAGACCTCAAGGCCAGCCGCCACACGGTTTCGCTCCTCGGCCAACGTTTTGGACCTCTTGTCCCTTTTGTGGGAGCAG
GTATGAGTATGGGAGGGAGCATGTCAAGAGAGAAGTTGCTTGCCAGACTTGCAAAAAGCTGTTCACTGCTTTTGAAGTTT
CTTTTCCGACACAACAGAACATGTTTCCAGGACAAAGGGCTTGCGCTGAGCCTCACAAGCGTCCGGTTGATACTAAAAAT
GTGCCCTCTGGAAAGAAGGCCACGGCGGCTTCTACTGCAGAAAATAATAACGAAAAGAGGAAGAGGAAGAGAAAGGATAC
GGATGAGCCTAGTGAAAGCTCTGAGAGTGAGAGTAGCAGCGACTCGGAAGATGATAGTAACAATGTGCCCCCTGGAAAGA
AGGCGACGGCTTCTACTGTGGAAAACAATAACGGAAAGAGGAAGAGAAAGGATATAGATGAGTGTAGTGAAAGCTCTGAC
AGTGAGAGTAGTAGCGACTCAGAAGATGATGATACTATGGCAGCAGGAAATAATATGGGATCCAATGGAGGACAGGAGCC
TCGGAGGTCAGTACGTAGCAAGCGTCAGGTTTCTTATAACGAGAATGTGAGCGACGATGATGATGTTGACTTAGTCAACG
ACGTTGGGGAAGGTGAAAATGTAGATACTGAAAAGGTAGATGAGGATCATCATCACCAGTCTACTGAAGCCTTGAACCCA
AAGGAGAAGATACAAGTAAGCTTAGATGATTCGGAGGACGAGGAGTCAAGTTTAGGAGGTGAAGCAGCAGCAGAAGAAGA
AGCAAATGTTATCAACTGTGAGGATCCTGAGTTTTCAGACTTTGATAAGCTGAGGGAGAAGAGCTGTTTTAGTGAACGTC
AGGTGTGGGCTTTGTATGATGAAGGAGAGGGGATGCCTAGATTCTATGCCGTCATAAAAAAAGTTACAAAACCAAGATTC
TCGGTTAAGTACGTTTGGTTAGAGCCTGATGAAACAAGAGACTTGCCTGTGTCTGTTGGTAGGTACGTACTTGGGGATGA
GGGTAAGACAAGTAGCTGTGACTTATTCTCTCATCTGGTTCAAAGCAAAACGAGAAGCAACGCTAAGAACTTCACTGTGT
TCCCGGGGAAAGGAGAAACGTGGGCTCTTTTCAAGAACTGGGACATGGAGGAGGAGGAGGACTCGGATTCTCCACGTGAG
TACGAGTTTGTTGAGATACTGTCTGATCATGAAGAGGGAGGCGGGACGGTGTCTGTGGGGTTCTTGTCTAAAGTGGAAGG
GTTTAAGTATGTGTACAGTCCATTGCCGGAGGAGGAAGCGGATACTTTTGAGATTCCGCCTCATGAGTTGTTTAGATTCT
CGCATAGGGTACCGTCGTTTAGATTGAAGGGAACAGAAGGGAGAGGGGTGCTGGAAGGTTGGTTTGAGCTTGATCCAGCT
GCTTTGCCAGTTCCTGTCTCTCAAGACCAAGACCATCATCAATCTCCACCACCTTGA