Details for Chinese cabbage Locus Brara.E03289

Position : A05 ( 5`- 26632610 .. 26636869 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03289

Protein [Map View]
MAPSSSANVRPSHILSIPRPSPTCVPNLRLLASGFSLIFKSSYLSAELSSRQTRSVQVPVVSSTRKQRRSMEQSNVYVAS
NSMETEIGSQKITKNPSLICAPVMADSINKMVTETCKARELGADLVEIRLDSLKGFNPLEDLKTIIKKSPLPTLFTYRPK
WEGGQHEGDENERLDVLRLAMELGADYVDVELQVASEFIKSIKGKKPKNFRVIVSSHNYQNTPSLEDLSDLSVRIQQAGA
DIVKIVTTSVDITDVARMFHITSNAQIPTIGLVMGQRGLMSHILCSKFGGYMTFGTLEYGKVSAPGQPTIKDLLDLYNFR
RIGPDTKVYGVIGQPVSHSKSPVVHNQAFKSVDFNGVYVHLLVDDVASFLKAYSSSDFVGFSCGIPHKEAALTCCDEVDP
LAKSIGAVNTILRRKSDGKLLGYNTDCIGSISAIEDGLRSSSRCTSASPLAGKTVVVIGAGGAGKAVAYGAKVKGAKVVI
ANRTYERALEVAEAIGGRAVSLADLENFHPEDGMVLANTTSVGMQPNVDETPISKHALEHYALVFDAVYTPRITRLLREA
EECGAVTVSGSEMFVRQAYEQFEIFTGLPAPKELYWKIMSKY*

DNA
ATGGCTCCTTCTTCTTCAGCTAATGTACGTCCTTCTCATATCCTCTCCATCCCACGACCGTCACCGACCTGCGTTCCCAA
CCTCCGTCTCCTGGCCTCCGGTTTCAGTCTCATCTTCAAATCGAGTTACTTATCCGCCGAACTCTCTTCCCGGCAAACCA
GGAGTGTGCAGGTTCCTGTAGTTTCCTCCACTCGAAAGCAACGTCGAAGCATGGAACAAAGCAATGTCTATGTGGCTTCA
AATTCTATGGAAACGGAGATTGGAAGTCAAAAAATCACCAAGAATCCGAGCTTGATCTGTGCTCCAGTGATGGCGGATTC
AATAAACAAGATGGTGACTGAAACGTGCAAAGCACGTGAACTGGGTGCAGATTTGGTGGAAATTCGATTAGATAGTCTCA
AGGGTTTCAACCCTCTTGAGGATCTTAAAACAATCATTAAAAAATCTCCTCTTCCCACTCTGTTCACCTACAGACCAAAA
TGGGAAGGTGGTCAACATGAAGGTGATGAAAATGAGCGTCTGGATGTGCTCCGTTTGGCCATGGAACTAGGAGCTGATTA
CGTTGATGTTGAACTTCAGGTTGCAAGTGAGTTCATCAAATCGATTAAAGGAAAGAAGCCTAAAAATTTTAGAGTTATTG
TTTCATCACACAACTATCAGAATACCCCTTCCCTTGAGGATCTCAGTGACCTTTCTGTAAGAATACAACAGGCTGGAGCC
GACATAGTGAAAATTGTTACTACTTCTGTTGACATCACAGATGTTGCTCGCATGTTCCATATAACTTCAAATGCTCAAAT
TCCCACAATAGGACTTGTTATGGGTCAAAGGGGTCTAATGTCTCATATTCTTTGTTCAAAATTTGGTGGATATATGACCT
TTGGCACCTTGGAATATGGAAAAGTGTCTGCACCTGGTCAACCAACGATCAAGGATCTGTTGGATCTTTACAACTTTAGA
AGAATTGGTCCTGACACCAAGGTTTATGGAGTTATTGGCCAGCCTGTCAGTCACAGCAAATCACCTGTTGTCCACAATCA
AGCTTTCAAATCAGTTGATTTTAATGGAGTATATGTTCACCTATTAGTTGATGATGTTGCAAGCTTTCTCAAAGCATACT
CATCCTCTGATTTCGTTGGATTCAGCTGTGGAATTCCTCACAAAGAAGCTGCATTGACATGTTGTGATGAGGTTGATCCA
TTGGCAAAGTCTATAGGAGCTGTGAACACTATACTAAGGAGAAAAAGTGATGGAAAGTTGCTGGGTTACAACACGGATTG
TATTGGTTCCATTTCTGCTATTGAAGATGGCCTTCGAAGCTCAAGTCGTTGTACATCTGCTTCGCCATTAGCCGGTAAAA
CAGTGGTGGTTATTGGTGCTGGTGGAGCAGGCAAGGCAGTTGCTTATGGTGCAAAAGTGAAGGGAGCCAAAGTTGTAATT
GCTAATCGAACTTATGAACGAGCACTAGAGGTTGCAGAAGCAATCGGAGGCAGAGCGGTATCTCTAGCGGATTTAGAGAA
CTTCCATCCAGAAGACGGCATGGTTTTGGCCAACACCACTTCTGTAGGTATGCAACCAAATGTCGATGAGACTCCCATTT
CCAAGCATGCATTGGAGCACTACGCACTAGTATTTGATGCGGTGTATACTCCAAGAATCACACGACTGTTACGGGAAGCA
GAAGAATGTGGAGCCGTAACAGTGTCGGGGTCAGAGATGTTTGTGAGGCAGGCTTACGAGCAGTTTGAGATTTTCACTGG
TTTGCCCGCTCCAAAGGAACTCTACTGGAAGATCATGTCAAAGTACTGA