Details for Chinese cabbage Locus Brara.E03277

Position : A05 ( 5`- 26512571 .. 26514811 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03277

Protein [Map View]
MDEKGRNLKNNNMEDEMDLKRGPWTAEEDFKLMNYIATHGEGRWNSLSRCAGLQRTGKSCRLRWLNYLRPDVRRGNITLE
EQLLILELHSRWGNRWSKIAQYLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDTMKYLWMPRLVERIQSASAAATV
ATTTKTTTTTGSAATSSSNTTSNNQFMTYDYNNNSMGQQFGVVNNDYITPDNSNVAVSPMSDLTEYYSAQNTYPEYYSGQ
VGNNYYPDQDLVVPQILPDNYLDYSGLLDEDLAVMQEQSNLNWFEDINGATSSSDSLWNIGESDEDLWFLQDQQQFNNNG
NF*

DNA
ATGGATGAGAAAGGAAGAAACTTGAAGAACAACAACATGGAAGACGAAATGGACCTGAAGAGAGGTCCATGGACTGCTGA
AGAAGATTTTAAGCTCATGAATTACATTGCTACTCATGGAGAAGGTCGATGGAACTCTCTTTCTCGTTGTGCAGGACTCC
AACGCACCGGTAAAAGCTGTAGGTTACGGTGGTTAAACTATCTCCGCCCTGATGTCCGCCGTGGAAACATTACCCTCGAA
GAACAACTCTTGATTCTCGAACTTCATTCCCGTTGGGGCAATCGATGGTCAAAAATCGCACAATACCTACCGGGAAGAAC
AGACAATGAGATCAAAAACTACTGGAGAACCCGAGTTCAAAAACATGCAAAGCAGCTTAAATGCGACGTGAACAGTCAGC
AATTCAAAGACACAATGAAGTATTTGTGGATGCCTAGGCTGGTCGAGAGGATCCAATCTGCCTCGGCCGCAGCCACCGTA
GCCACAACCACCAAGACCACTACCACGACAGGATCAGCCGCTACGTCATCTAGCAACACAACCTCTAACAATCAATTCAT
GACGTATGATTACAACAACAACAGCATGGGACAACAATTTGGTGTAGTGAACAACGATTATATCACGCCCGATAACTCTA
ACGTGGCAGTGTCTCCGATGTCAGATTTGACGGAGTACTACAGCGCTCAAAACACGTACCCGGAATACTATTCGGGTCAA
GTGGGGAATAACTATTATCCGGATCAGGACTTGGTGGTTCCGCAAATATTACCGGATAATTATTTGGATTATTCTGGATT
ATTAGACGAAGATTTGGCGGTTATGCAGGAGCAGAGTAACCTTAACTGGTTTGAAGATATTAATGGAGCTACTTCTTCTT
CAGACAGTTTATGGAACATTGGAGAAAGTGATGAAGACTTATGGTTTTTACAGGATCAACAACAGTTCAACAATAATGGC
AACTTCTGA