Details for Chinese cabbage Locus Brara.E03273

Position : A05 ( 5`- 26479136 .. 26482044 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03273

Protein [Map View]
MSDLPPYPPLDPTTYDLIIVGTGVPSSILAAAASSSGTSVLHLDPNPFYGSHSASLSLPDLTSFLHSNSLSPPSPPPPSD
TPDFLSVDLATRSLYSSVEIATFDSSILDERHSRKFNVDLCGPRVLFCADESINLMLKSGSNNYVEFKSVDASFVGDSSG
ELRSVPDSRAAIFKDKSLGLMEKKQLMKFFKLVQAHLAAAAASSTESDEGAVKIAEEDMESPFVDFLAKMPLPPKIKSII
LYGIAMVDYDQDNVEACGDLLKTREGIARLALYITSIGRFSNALGALIYPIYGQGELPQAFCRRAAVKGCIYVLRMPITA
LLLDKETGGYKGVRLATGQEIFSQKLILDPCITVGSESMSSLTDQQKETLRVLVPKSISSEGKIARGICIIRGSVKADIS
NALVVYPPKSLFPEQLAAIRVLQLGSGLAVCPADMHVLYFSTVCENDDQGKAALLSAMSTLIKPQVPENLQSDSAVENDT
AEAAKPVVLWRALYVQAMVKGEFGGSISSAASPDGNLSYNELVESAVKLYEQLMGSEELFKEETSPDNTTEEENDGGVEI
EA*

DNA
ATGAGCGACCTCCCTCCATATCCGCCGCTCGATCCCACCACCTACGACCTCATCATCGTCGGCACCGGAGTTCCCTCATC
CATCCTCGCCGCCGCCGCTTCCTCCTCCGGCACCTCAGTTCTCCACCTCGATCCCAACCCCTTCTACGGCTCTCACTCCG
CATCCCTCTCCCTCCCCGATCTCACTTCCTTCCTCCACTCAAACTCCCTCTCCCCTCCCTCTCCTCCGCCGCCGTCAGAC
ACTCCCGACTTCCTCTCCGTCGATCTCGCCACACGATCCCTATACTCCTCCGTCGAGATCGCGACCTTCGACTCCTCGAT
CCTCGACGAACGCCACTCCAGGAAGTTCAACGTCGACTTGTGCGGTCCTAGGGTTCTCTTCTGCGCCGACGAGTCGATCA
ACCTAATGCTGAAGTCGGGATCTAACAACTACGTGGAGTTCAAGAGCGTCGACGCGAGCTTCGTCGGGGACTCGAGCGGA
GAGCTGAGGAGCGTCCCGGATTCGAGAGCGGCGATATTCAAGGATAAGAGTTTGGGGCTGATGGAGAAGAAGCAGTTGAT
GAAGTTTTTTAAGCTTGTTCAAGCTCACTTGGCTGCTGCTGCTGCTTCCTCCACGGAGAGCGATGAGGGGGCGGTTAAGA
TTGCTGAGGAAGATATGGAGTCTCCGTTTGTTGACTTCTTGGCTAAGATGCCTTTGCCTCCCAAAATCAAATCGATCATC
TTGTATGGCATTGCGATGGTAGACTATGATCAAGACAATGTGGAAGCTTGTGGAGATTTACTCAAGACTAGAGAGGGGAT
AGCTCGATTGGCTTTGTACATTACATCTATTGGCAGATTTTCAAACGCACTTGGGGCGTTGATATATCCTATTTATGGAC
AAGGAGAGCTTCCACAAGCCTTTTGCCGTAGAGCCGCTGTCAAAGGATGCATCTATGTTCTCCGGATGCCTATTACTGCT
CTGCTTTTAGACAAGGAAACTGGGGGTTACAAAGGGGTTAGACTAGCTACGGGTCAAGAGATATTCAGCCAAAAGTTGAT
TCTTGACCCATGTATTACTGTTGGATCGGAGTCAATGTCGTCATTGACTGATCAGCAGAAAGAAACTCTTCGTGTTCTTG
TCCCAAAGTCGATAAGCAGCGAGGGGAAAATAGCTAGAGGAATTTGTATCATTAGAGGTTCTGTGAAAGCTGATATATCA
AACGCTCTTGTCGTATATCCACCTAAATCTTTGTTTCCTGAACAGTTAGCTGCGATTCGGGTTCTGCAGCTTGGTAGTGG
TTTAGCGGTTTGTCCAGCTGACATGCATGTTTTATATTTTTCAACTGTGTGTGAAAACGATGATCAAGGGAAAGCTGCAC
TGTTATCTGCCATGAGTACTCTCATTAAACCGCAGGTTCCTGAGAATCTCCAAAGCGATTCAGCTGTCGAGAACGACACT
GCTGAAGCAGCAAAACCTGTTGTGCTCTGGAGAGCACTGTACGTGCAAGCGATGGTCAAGGGTGAATTTGGAGGCAGTAT
CAGTTCAGCAGCTAGTCCAGATGGAAATTTGAGCTACAATGAGCTTGTGGAATCAGCCGTGAAGCTATATGAGCAACTCA
TGGGGAGTGAAGAATTGTTTAAAGAAGAAACTTCGCCGGACAACACAACAGAGGAGGAAAACGATGGTGGTGTTGAAATA
GAAGCTTGA