Details for Chinese cabbage Locus Brara.E03272

Position : A05 ( 5`- 26474662 .. 26478464 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03272

Protein [Map View]
MAISSSVTPGLMSVVLGIVPVIVAWLYAEYLHYAKHSVSAKAHSDVNLVEIVKDFVKEDDKALLIEDGGGLQSPSTKAKG
SSVHSPLIRFVLLDESFLVENRLTLRAIIEFVVLMGYFYLCDRTDVFSSSKKSYNRDLFLFLYFLLIIVSAITSFTIHND
KSAFNGKSIMYLNRHQTEEWKGWMQVLFLMYHYFAAAEYYNAIRVFIACYVWMTGFGNFSYYYIRKDFSLARFAQMMWRL
NFLVIFSCIVLNNNYMLYYICPMHTLFTLMVYGALGIMNKYNENGSVIAAKIVACFFVVIIVWEIPGVFEWIWSPFTFLL
GYNDPSKRQLPLLHEWHFRSGLDRYIWIIGMLYAYYHPTVESWMDKLEEAEIKIRMAIKTTVALIAITVGYFWFEYIYKL
DKYTYNKYHPYTSWIPITVYICLRNITQSFRGYSLTLLAWLGKITLETYISQFHIWLRSGVPDGQPKLLLSLIPEYPLLN
FMLTTSIYVAVSYRLFELTNTLKTAFIPTKDDKRLVYNTISAIIICTCLYFFSFVVVQIPQKLV*

DNA
ATGGCGATATCAAGCTCCGTTACGCCTGGGCTAATGTCGGTGGTGCTCGGGATCGTGCCTGTGATCGTTGCGTGGCTTTA
CGCCGAGTATCTTCACTATGCTAAACACTCAGTCTCCGCCAAAGCGCACTCTGATGTCAACTTGGTGGAGATTGTGAAAG
ATTTTGTTAAAGAAGATGATAAAGCTCTTTTGATAGAAGATGGAGGTGGTCTTCAGTCACCTTCTACCAAAGCCAAGGGC
TCCTCCGTACATTCTCCCCTCATCAGGTTTGTGCTCTTGGATGAGTCTTTCTTGGTTGAGAACAGGCTGACGTTGAGAGC
AATAATCGAGTTTGTTGTGCTTATGGGATACTTTTATTTATGTGACCGTACTGATGTCTTCAGTTCATCAAAGAAGAGTT
ACAACCGGGATCTCTTTCTGTTCCTTTACTTCCTTCTAATCATCGTTTCAGCCATAACCTCTTTCACGATACATAATGAT
AAATCAGCATTCAATGGAAAATCCATCATGTACTTGAATAGGCATCAAACCGAGGAGTGGAAAGGCTGGATGCAGGTCCT
GTTTTTGATGTACCACTACTTTGCTGCTGCGGAGTACTACAATGCTATCCGTGTGTTCATTGCTTGTTATGTGTGGATGA
CTGGATTTGGGAATTTTTCTTATTATTACATTCGCAAGGACTTTAGCCTCGCAAGGTTTGCACAGATGATGTGGCGGCTA
AATTTCCTGGTCATATTCTCCTGTATAGTCCTCAACAACAATTACATGCTATACTACATATGCCCAATGCACACTCTCTT
TACTCTGATGGTCTACGGAGCACTTGGTATCATGAACAAATATAATGAGAATGGTTCAGTCATAGCTGCCAAAATTGTTG
CCTGCTTCTTTGTTGTGATCATCGTTTGGGAGATTCCCGGCGTTTTTGAATGGATTTGGAGTCCGTTTACGTTCCTATTG
GGCTACAATGACCCCTCAAAACGGCAGCTTCCCCTCTTGCATGAGTGGCATTTCCGCTCGGGCCTTGATCGGTACATATG
GATAATCGGGATGCTCTATGCATACTACCACCCAACTGTTGAGAGTTGGATGGATAAACTGGAGGAAGCTGAGATAAAGA
TCAGGATGGCTATCAAAACAACTGTGGCACTGATAGCAATAACGGTGGGATATTTTTGGTTCGAGTACATATACAAGCTG
GATAAGTATACTTACAACAAATATCATCCTTACACCTCTTGGATTCCAATAACTGTTTATATCTGTCTCCGGAACATCAC
CCAGTCTTTCCGCGGCTACAGTTTGACCCTTCTGGCGTGGCTTGGGAAGATAACACTGGAGACATATATCTCCCAGTTTC
ATATATGGCTCAGATCTGGAGTTCCTGATGGTCAGCCCAAATTGCTACTTTCTCTGATCCCTGAATACCCATTGTTGAAC
TTCATGCTCACAACTTCCATTTACGTCGCTGTCTCTTATAGGCTCTTTGAGCTGACAAACACATTGAAAACAGCTTTCAT
ACCAACCAAAGACGACAAGCGCCTTGTCTACAACACCATCTCGGCAATCATAATCTGCACTTGCCTCTACTTTTTCTCGT
TTGTTGTCGTCCAAATCCCCCAAAAATTGGTGTGA