Details for Chinese cabbage Locus Brara.E03271

Position : A05 ( 5`- 26470502 .. 26473146 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03271

Protein [Map View]
MRRGGERYKGLPPYMAEIEEECSVSLRQLMVNEGLIPSPEDDKKRRSVIHMLQRIVVRWIKIVAWKRRLPQHHINATNAT
IIPYGSYGLGVHGSDSDIDALCIGPFFATIAEDFFIDLRDLLKTRSEVSEVHCVKDAKVPLIRFKFDGILVDLPYAQLRV
LSIPNNVDVLNPFFLRDINETSWRSLSGVRANQCILQIVPSVELFQSLLRCVKLWAKRRGVYGNLNGFLGGVHMAILAAF
VCGYNPNATLSSLVASFFSTFAYWQWPMPVVLLRDAFAATGSPPGLMPIQLPCGGRQYCNSNVTRSTYCKIMSEFHRGNH
LMKGYLKHGFNWNSLFEPYPYATTYAWFVKIHLSAANVEDLSDWVGWVKSRFRSLLIKIEEVFGLCDPNPTEHLEACEKQ
PNIVYYWGLHLRSINVSDIEPVETDFLKNVNNSGSFQGSVGGIQLSVVQASQLPKNVECDTSNRNKKVTRTCWRVRDDKQ
CKDKPVYSRHLPGYVVGYEKMNNNREAESTDVKC*

DNA
ATGAGAAGAGGAGGCGAGAGATATAAAGGTTTGCCTCCTTACATGGCTGAAATAGAAGAAGAATGCTCTGTTTCTCTTCG
TCAGCTTATGGTGAATGAAGGACTCATTCCATCTCCTGAAGATGACAAGAAACGAAGAAGCGTTATACATATGCTACAAA
GGATAGTAGTGAGATGGATTAAGATCGTTGCTTGGAAACGACGTCTTCCTCAGCATCATATCAACGCAACCAACGCCACC
ATAATCCCTTATGGCTCTTATGGTCTTGGGGTTCACGGTTCTGATTCAGACATTGACGCTTTGTGCATTGGTCCTTTCTT
CGCCACTATAGCTGAGGATTTTTTCATCGACTTGCGTGATCTGTTGAAAACCAGAAGCGAAGTGTCAGAGGTTCATTGTG
TTAAAGATGCTAAAGTCCCTCTCATCCGCTTCAAGTTTGATGGCATCTTGGTTGATCTTCCATACGCTCAGCTTCGAGTC
TTATCAATCCCAAACAATGTAGATGTGCTAAACCCTTTCTTTCTGAGAGACATTAATGAGACAAGCTGGAGAAGCTTGTC
TGGAGTTCGCGCTAATCAATGCATCCTTCAGATAGTGCCTTCCGTTGAGTTGTTTCAATCATTGCTGCGGTGTGTTAAAC
TATGGGCAAAGAGGCGTGGTGTATACGGTAACTTGAATGGGTTCCTTGGAGGAGTTCACATGGCTATTCTTGCTGCGTTT
GTCTGCGGATATAACCCCAACGCTACGTTGAGTTCCCTCGTGGCTAGTTTCTTTAGCACGTTTGCTTATTGGCAGTGGCC
CATGCCTGTGGTTCTCCTAAGGGATGCCTTTGCAGCTACTGGCTCTCCTCCAGGGCTAATGCCTATCCAGCTGCCTTGCG
GTGGACGTCAGTACTGTAACTCAAACGTAACGAGAAGCACGTATTGCAAGATCATGTCAGAGTTTCACCGAGGGAATCAT
TTGATGAAGGGCTACTTGAAACATGGCTTTAACTGGAATAGTTTGTTTGAGCCTTATCCTTATGCAACCACGTACGCTTG
GTTCGTCAAGATACACCTCTCTGCGGCTAATGTTGAAGATCTGAGTGATTGGGTTGGTTGGGTTAAGTCACGTTTCCGCT
CTCTTCTTATCAAAATAGAGGAAGTCTTTGGACTTTGTGATCCAAACCCAACAGAGCATTTAGAAGCCTGTGAAAAGCAG
CCAAACATTGTATACTACTGGGGGTTACATCTCAGAAGCATAAATGTTTCGGACATTGAGCCCGTGGAAACAGACTTTCT
GAAGAATGTTAACAACAGCGGAAGCTTCCAGGGATCAGTTGGTGGAATCCAGTTATCAGTTGTGCAAGCGTCTCAGCTTC
CTAAGAATGTTGAGTGTGATACAAGTAACAGAAACAAGAAGGTGACAAGGACGTGTTGGAGAGTCCGGGATGATAAGCAG
TGCAAGGATAAACCGGTTTACTCAAGGCATTTGCCCGGTTATGTGGTTGGGTATGAGAAGATGAATAATAATAGAGAGGC
TGAGAGTACTGATGTTAAGTGTTAG