Details for Chinese cabbage Locus Brara.E03270

Position : A05 ( 5`- 26467331 .. 26470373 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03270

Protein [Map View]
MAKQEEVTVPIFTSLDPVYGEGSQLQEANSRFDALKSKFNQAFGASPQLFARSPGRVNLIGEHIDYEGYSVLPMAIRQDT
IIAIRKREGQNELRIANVNKKYSMCTYPADPLQEIDLKNHKWGHYFICAYKGFHEYAKSKGVNVDSPVGLDVVVDGIVPT
GSGLSSSAAFVCSSTIAIMAVFGENFEKKELAQLTCECEQHIGTQSGGMDQAISIMAKTGFAELIDFNPVRATDVKLPDG
GSFVIAHSLAESQKAVTAATNYNNRVVECRLASIILGIKLGMEPKEAISKVKTLSDVEGLCVSFAGDRGSSDPVLAVKEY
LKEEPYTAEEIEKIVDEKLPSILNNDPTSLAVLNAATHFKLHQRAAHVYSEARRVHGFKDTVYSNLSDEEKLKKLGDLMN
DSHYSCSVLYECSCPELEELVKVSRENGALGARLTGAGWGGCTVALVKESGVSQFIAAVKEKYYKKRIEKGVVKEEDMEL
YLFASKPSSGAAIFNV*

DNA
ATGGCGAAACAAGAAGAAGTCACGGTCCCGATCTTCACATCCCTTGATCCTGTCTACGGCGAAGGATCTCAGCTCCAAGA
AGCTAACTCACGATTCGACGCTTTGAAATCCAAATTCAACCAAGCCTTCGGTGCTTCTCCCCAGCTCTTCGCTCGCTCTC
CCGGAAGAGTGAATCTGATCGGAGAGCATATTGACTATGAGGGTTACTCTGTGTTACCAATGGCTATTCGTCAGGACACT
ATTATTGCAATACGGAAACGTGAGGGTCAGAATGAGTTGAGGATTGCAAACGTGAATAAGAAGTACTCCATGTGTACTTA
TCCTGCTGATCCTCTCCAGGAGATTGACTTGAAGAATCACAAGTGGGGTCATTACTTCATCTGCGCGTACAAAGGGTTTC
ATGAGTATGCAAAGTCAAAAGGGGTGAATGTTGATTCACCTGTTGGACTTGATGTGGTTGTTGATGGCATTGTTCCTACA
GGGTCTGGGCTGTCAAGTTCTGCTGCCTTTGTTTGCTCATCAACAATTGCTATTATGGCTGTCTTTGGTGAAAACTTTGA
AAAGAAAGAACTTGCACAGCTTACATGTGAATGTGAACAACACATTGGAACACAATCTGGTGGGATGGACCAGGCAATCT
CTATTATGGCTAAAACTGGTTTCGCTGAGCTTATTGACTTCAACCCAGTCCGTGCCACCGATGTGAAACTCCCTGATGGA
GGGAGTTTTGTGATCGCACACTCTCTTGCAGAGTCTCAGAAGGCGGTCACAGCTGCGACTAATTACAACAACAGGGTCGT
TGAGTGCCGACTTGCTTCGATCATACTTGGCATTAAGCTCGGAATGGAACCAAAAGAAGCAATATCAAAAGTTAAGACTC
TCTCTGATGTGGAAGGATTATGTGTGTCGTTTGCTGGTGACCGTGGCTCCTCTGATCCTGTTCTAGCTGTTAAGGAATAT
CTGAAAGAAGAACCATATACGGCTGAGGAGATTGAGAAAATCGTGGATGAGAAGTTACCATCGATCTTGAACAACGATCC
AACATCTTTAGCTGTACTTAATGCTGCAACGCATTTCAAATTGCATCAGAGAGCTGCACACGTTTACTCTGAAGCACGGA
GAGTTCATGGTTTCAAGGACACTGTCTATTCAAACTTAAGTGACGAAGAGAAGTTGAAGAAGCTTGGTGATCTCATGAAT
GACAGCCATTACAGCTGTAGTGTGCTATACGAGTGCAGTTGCCCGGAGTTAGAAGAACTAGTTAAAGTGAGCAGGGAGAA
TGGAGCACTTGGAGCAAGACTTACCGGAGCTGGATGGGGTGGTTGCACTGTGGCTTTGGTTAAAGAATCTGGCGTCTCTC
AGTTCATCGCTGCGGTTAAGGAGAAGTACTACAAGAAGAGGATAGAGAAAGGAGTGGTGAAGGAAGAAGACATGGAGCTT
TACCTTTTTGCCTCCAAGCCTTCAAGTGGTGCTGCCATCTTCAACGTCTAA