Details for Chinese cabbage Locus Brara.E03269

Position : A05 ( 5`- 26463839 .. 26464735 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03269

Protein [Map View]
MASLTSDNEQPPTNSNSSSTDHVRKKKSLFASSPSSSRGNAASVPTRDGDSHPRWRSEKQQRIYSAKLIQALRQVRLSSS
SSATTSSPTAQKRGKAVREAADRALAVSARGRTLWSRAILANRIKLKFRKQKRPRQTVIPAVTTVVTTGATSSRGRKRRV
SVVGLNKKSLPTVNRKVRSLGRLVPGCKKESVPVILEEATDYIQALEMQVRAMNSLVELLSGYSTPGSDSAPPPI*

DNA
ATGGCGTCTCTGACCTCCGATAACGAACAACCGCCGACGAATTCAAACTCAAGTTCTACAGATCATGTTAGAAAGAAGAA
GAGCTTATTTGCTTCCTCCCCCTCCTCGTCTCGTGGAAACGCAGCTTCCGTACCAACCAGAGACGGTGACAGCCACCCGC
GATGGAGATCGGAGAAGCAACAGCGTATCTACTCCGCCAAGCTGATCCAGGCGCTGAGACAGGTCCGCCTCAGCTCTTCC
TCCTCCGCGACGACATCATCTCCAACGGCTCAGAAGCGAGGGAAAGCAGTCCGCGAAGCCGCGGACCGCGCCCTCGCCGT
TTCCGCCCGCGGGAGGACGCTCTGGAGCAGAGCGATTCTTGCTAACCGGATCAAACTGAAGTTCCGGAAGCAGAAACGGC
CGAGGCAGACGGTTATACCGGCCGTGACCACGGTGGTCACGACGGGAGCTACTAGCAGCAGAGGGAGGAAACGGAGAGTG
TCGGTGGTGGGACTGAATAAGAAGAGTTTACCGACGGTTAACCGGAAAGTTCGTTCTCTCGGCCGGTTAGTTCCGGGTTG
CAAAAAAGAATCAGTACCGGTTATTCTAGAAGAAGCAACCGATTACATACAAGCACTGGAGATGCAAGTTAGAGCCATGA
ACTCTCTAGTGGAGCTTCTCTCCGGCTACTCAACCCCCGGCTCAGACTCAGCTCCTCCGCCTATTTGA