Details for Chinese cabbage Locus Brara.E03268

Position : A05 ( 5`- 26430436 .. 26432755 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03268

Protein [Map View]
MKEIQIPRKNSTRSSDPATKRIIIKDPELKNRKKRQSATVGSTKDPSDFDPIYFAISDHEAESFLQGSSVDLLPTPEICD
ESPVSTVTNEAFHVIDAAIAADLPASVQSLRDEISDLKKTICSVESSDESKRIDGAVTLKFRVVVFAFVLWALFAAVVVG
VSSGEEVAYSGPLPT*

DNA
ATGAAGGAAATTCAAATTCCCAGGAAAAACTCTACGCGCTCATCTGATCCCGCAACGAAGAGGATCATCATCAAGGATCC
TGAGCTCAAGAATCGAAAGAAGAGACAGAGCGCAACCGTCGGAAGCACGAAGGATCCATCTGATTTCGATCCGATCTATT
TCGCGATCTCCGATCACGAAGCTGAGAGTTTCCTACAAGGATCGAGTGTAGACCTCTTACCAACGCCAGAGATTTGTGAC
GAATCTCCAGTTTCAACCGTTACTAACGAGGCTTTTCACGTCATCGACGCTGCGATTGCTGCGGACTTGCCTGCTTCTGT
GCAGTCCTTGCGCGACGAGATCAGCGACCTGAAGAAAACGATCTGTTCAGTTGAGAGTTCTGATGAAAGTAAACGGATCG
ATGGAGCTGTTACTCTCAAGTTCCGCGTTGTGGTTTTCGCTTTCGTCCTTTGGGCTCTCTTTGCTGCGGTTGTGGTCGGA
GTCAGCTCAGGAGAGGAGGTTGCTTACTCTGGACCACTTCCAACTTGA