Details for Chinese cabbage Locus Brara.E03264

Position : A05 ( 5`- 26411158 .. 26413354 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03264

Protein [Map View]
MARIKPQALLNQSKKKKGPSRISISTIVVCNLVVAVVVLSLVTTYRHWSQRSRNTLETQSHSFEDTNAVSQQKNYDLPGY
ADISTSKGLITVELFKDASPEAVDKFLDLCQKDHFKGMPFHRVIKNYLVQAGHSSSSIPIEEWTAKGKLRGRLDTSPKHE
AFMLGTPKNKGNNKDFELLITTAPIPDLNDQLIVFGRVLKGEDVVQEIEEVDTDEHFQPKSQIGIISIVLKREL*

DNA
ATGGCGAGGATAAAACCTCAGGCTCTGCTTAATCAAAGCAAGAAGAAGAAGGGTCCTAGTCGCATAAGTATTTCTACAAT
TGTCGTGTGTAATCTCGTAGTTGCTGTAGTTGTACTCTCCTTGGTCACTACTTATCGTCATTGGTCCCAGAGGTCAAGAA
ACACACTTGAAACCCAGAGCCATAGTTTTGAGGACACAAATGCTGTATCACAACAAAAGAATTACGATCTTCCTGGTTAT
GCCGATATAAGCACATCAAAAGGTCTCATAACTGTGGAACTCTTTAAAGATGCTTCCCCTGAAGCTGTCGACAAGTTTCT
AGATCTATGTCAAAAGGATCACTTTAAGGGAATGCCGTTTCATCGGGTAATAAAAAACTATTTGGTGCAAGCTGGTCACT
CCTCGAGTTCTATACCTATAGAAGAGTGGACAGCTAAAGGAAAGCTCCGTGGTCGCCTTGACACAAGCCCAAAACATGAG
GCGTTCATGTTGGGAACACCAAAGAACAAAGGGAACAACAAGGACTTTGAACTTCTGATCACAACAGCGCCAATCCCGGA
TCTGAATGATCAGCTTATAGTGTTTGGAAGAGTTCTTAAAGGAGAGGATGTAGTTCAGGAGATTGAGGAAGTGGATACAG
ATGAGCATTTCCAGCCAAAATCGCAGATAGGGATCATTAGCATTGTACTGAAACGAGAATTATGA