Details for Chinese cabbage Locus Brara.E03259

Position : A05 ( 5`- 26382460 .. 26384042 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03259

Protein [Map View]
MALVQSRTLPRLTVPFSPILSTLHAPSSLFLRREIRPVASPFSSSTAGSFPLSPLTHPRKIICPPPRGKFVREDYLVRKL
SAQELQELVKGERKVPLIVDFYATWCGPCILMAQELEMLAVEYESNAMIVKVDTDDEYEFARDMQVRGLPTLFFISPDPS
KDAIRTEGLIPIQMMRDIIDNDL*

DNA
ATGGCTCTTGTTCAATCCAGAACTCTTCCTCGCCTCACCGTCCCCTTCTCGCCGATTCTGTCCACACTCCACGCACCGTC
GTCTCTCTTTCTCCGGAGGGAAATTCGACCGGTAGCCTCGCCGTTCTCGTCCTCCACCGCCGGGAGCTTTCCCCTCTCGC
CGCTGACGCATCCAAGGAAGATTATCTGCCCTCCACCTCGCGGCAAGTTTGTTAGAGAAGATTATCTTGTGAGGAAACTG
TCAGCTCAAGAACTTCAAGAACTGGTGAAAGGAGAGAGGAAGGTGCCGTTGATTGTTGATTTTTATGCTACTTGGTGTGG
ACCTTGTATCTTGATGGCCCAGGAACTCGAAATGCTTGCAGTGGAGTATGAGAGCAATGCAATGATTGTGAAAGTTGATA
CAGATGATGAGTACGAGTTTGCTCGCGACATGCAGGTTCGGGGATTACCTACATTGTTCTTCATCAGCCCTGACCCAAGC
AAAGATGCAATCAGGACAGAAGGGCTGATTCCAATACAGATGATGCGTGACATCATTGACAACGACTTGTGA