Details for Chinese cabbage Locus Brara.E03256

Position : A05 ( 5`- 26375598 .. 26376185 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03256

Protein [Map View]
MELSLIAETVAFSTAKQCVAFGSSLLLLNRANHVSFTADSLVDQSPAGIVQASAAVIFPVDAIAPSPVRSSSYKTIRRIR
KRRRAKRVSYGGDSEDGGDFGRFLLESGFGGSDGPFGFGGGGGGKGWNYGGGGGGGNWDESSSSSSWSDPAMEFVYEVIC
WIALSNCVHFAFKRIVRIVTDGEREKLNLTLSPVC*

DNA
ATGGAGCTCTCTCTGATCGCTGAAACGGTAGCGTTTTCCACGGCTAAGCAATGCGTAGCGTTCGGGAGCTCTCTCCTTCT
TCTCAATCGAGCAAATCACGTTTCATTCACCGCTGATTCCCTCGTCGATCAGTCTCCGGCGGGAATCGTTCAAGCATCGG
CGGCGGTTATCTTCCCCGTCGATGCGATCGCTCCTTCGCCGGTTAGATCTAGCTCTTACAAGACGATCCGCCGGATCCGC
AAAAGGCGGCGTGCGAAGCGCGTTTCGTACGGCGGCGATTCGGAGGACGGAGGGGATTTCGGTCGGTTTCTGTTAGAAAG
CGGGTTCGGTGGTAGCGACGGTCCGTTCGGGTTTGGCGGTGGAGGCGGTGGGAAGGGGTGGAACTACGGCGGAGGCGGTG
GTGGTGGAAATTGGGATGAGTCGTCGTCGTCGTCTTCTTGGTCGGATCCGGCGATGGAGTTCGTGTACGAAGTGATTTGC
TGGATCGCTTTGTCTAATTGTGTGCATTTTGCGTTCAAGAGGATAGTGAGGATCGTTACCGACGGTGAAAGGGAGAAGTT
GAACCTGACATTGTCTCCGGTCTGCTGA