Details for Chinese cabbage Locus Brara.E03255

Position : A05 ( 5`- 26370226 .. 26374871 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03255

Protein [Map View]
MGSNTGDLVTRVQPAHLFDHDALFRYAADNVSGFPTNPSQFTISQFGHGQSNPTFLIAVGSGSSSKRYVLRKKPPGKLLQ
SAHAVEREFQVLKALGEHTQVPVPKVFCLCTDPSVIGTAFYIMEFMEGRIFIDPKLPNVAPERRTAIYRAAAKALASLHS
ADVDTIGLDKYGRRANYCQRQIDRWFKQYLASTNEGKPVRNPKMFELVDWLRKSIPAEDSTGATSGLVHGDFRIDNLVFH
PYEDRVIGILDWELSTLGNQMCDVAYSCMHYIVNVQLDKEHVSEGLETTGLPDGILSMPEFLLEYCSALGKPWPAANWKF
YVAFSLFRAASIYTGVYNRWLMGNASAGERARNTGVQANELVECALGYIARENVLPAHPPSGKRDVSRPSYESLVDGTGR
FVPNRKVLELRGKLVKFMETHIYPMEKEFAKLAQSDLRWTVHPEEERLKEEAKRQGLWNLFIPVDSAARARRELTAIENK
QSFDQLFGEGLTNLEYGYLCEIMGRSVWAPQVFNCGAPDTGNMEVILRYGNKEQIAEWLIPLLEGKIRSGFAMTEPQVAS
SDATNIECSIRRQGDSYVINGTKWWTSGAMDPRCRVLILMGKTDFNAPKHKQQSMILVDMRTPGIHVKRPLTVFGFDDAP
HGHAEISFENVIVPAKNILLGEGRGFEIAQGRLGPGRLHHCMRLIGAAERGMELMAQRALSRKTFGVFIAQHGSFVSDLA
KLRVELEGTRLLVLEAADHLDQFGNKKARGILAMAKVAAPNMALKVLDTAIQVHGAAGVCSDTVLAHLWATARTLRIADG
PDEVHLGTIGKLELQRASKL*

DNA
ATGGGGAGTAACACCGGCGATCTGGTGACACGTGTCCAACCAGCTCATCTGTTCGACCACGACGCCTTGTTCCGTTACGC
CGCCGACAACGTCTCCGGTTTTCCGACCAACCCATCTCAATTCACCATCTCACAGTTCGGACATGGTCAGTCAAACCCCA
CCTTTCTGATAGCTGTCGGCTCGGGAAGTTCCTCGAAACGCTACGTTTTGAGGAAGAAGCCTCCTGGGAAGCTCTTGCAA
TCTGCTCATGCTGTTGAAAGGGAGTTTCAGGTGCTTAAGGCTCTGGGTGAGCATACCCAAGTTCCTGTCCCCAAAGTCTT
CTGCTTATGCACTGACCCTAGTGTGATCGGGACTGCTTTTTACATTATGGAGTTCATGGAAGGAAGAATCTTCATAGATC
CCAAGTTACCTAATGTAGCGCCAGAGAGAAGAACTGCGATCTATCGTGCAGCCGCCAAAGCCTTAGCTTCTCTTCATTCT
GCTGATGTTGATACGATTGGTCTTGACAAATATGGCCGTCGTGCTAACTACTGCCAAAGACAGATAGATAGGTGGTTCAA
ACAGTACTTGGCTTCAACAAACGAAGGCAAACCCGTAAGGAATCCAAAGATGTTTGAGCTTGTTGACTGGTTACGCAAAA
GCATACCCGCTGAAGATTCAACAGGAGCAACATCAGGCCTTGTCCATGGAGACTTCCGCATTGACAATCTAGTGTTTCAT
CCTTATGAGGATCGAGTTATTGGAATACTTGACTGGGAACTGTCCACGCTTGGGAACCAAATGTGTGATGTTGCATACAG
TTGTATGCATTACATTGTGAATGTTCAGCTCGATAAGGAGCATGTCAGTGAAGGTCTTGAAACTACTGGACTCCCAGACG
GAATACTTTCTATGCCAGAGTTTCTCTTAGAGTACTGTTCCGCACTGGGGAAACCATGGCCTGCTGCAAACTGGAAGTTC
TACGTAGCCTTCTCTTTGTTCCGGGCTGCTTCTATCTACACAGGCGTGTACAACAGATGGTTAATGGGGAATGCTTCAGC
CGGTGAACGTGCCAGGAACACAGGGGTTCAAGCCAATGAGCTTGTAGAGTGTGCCTTGGGTTACATCGCACGTGAGAATG
TTCTTCCTGCGCACCCTCCATCTGGTAAAAGAGATGTGAGCCGCCCATCGTATGAAAGCCTTGTGGATGGAACCGGGAGA
TTCGTTCCCAACAGAAAAGTGTTGGAGCTAAGGGGGAAGCTGGTCAAGTTTATGGAGACTCACATCTACCCGATGGAGAA
AGAGTTCGCCAAACTTGCTCAGTCAGATTTGCGGTGGACCGTTCACCCTGAGGAGGAGAGGTTAAAGGAGGAGGCAAAGA
GACAAGGCCTATGGAACTTATTTATTCCTGTGGATAGTGCTGCTAGAGCTCGAAGAGAACTGACAGCTATTGAGAATAAA
CAATCTTTTGATCAATTGTTTGGTGAGGGCCTCACGAATTTGGAGTATGGTTACCTTTGTGAGATCATGGGTCGTTCGGT
TTGGGCTCCACAGGTGTTCAACTGTGGTGCACCTGATACTGGAAACATGGAGGTGATACTTCGGTATGGAAACAAAGAAC
AAATTGCTGAATGGCTTATTCCTCTGCTTGAGGGAAAGATTCGTTCTGGATTTGCTATGACTGAGCCACAAGTTGCTTCT
TCTGATGCAACCAATATTGAGTGCTCTATTAGAAGACAAGGTGATTCATATGTTATCAATGGCACAAAATGGTGGACAAG
TGGAGCCATGGATCCAAGGTGCAGAGTGCTTATTCTCATGGGGAAAACTGATTTCAACGCACCAAAACATAAGCAACAGT
CAATGATACTAGTGGACATGCGGACTCCAGGTATACACGTGAAGAGACCTCTCACGGTGTTTGGTTTTGACGACGCGCCT
CATGGACATGCTGAGATTTCTTTTGAGAATGTGATTGTCCCGGCGAAGAATATTCTCCTAGGAGAAGGCCGAGGTTTCGA
GATTGCTCAGGGAAGGTTAGGCCCTGGAAGATTGCACCATTGCATGAGACTAATAGGTGCAGCAGAGCGTGGGATGGAGC
TAATGGCTCAAAGAGCTCTTAGTAGAAAGACTTTTGGGGTGTTCATAGCGCAGCACGGTTCTTTCGTCTCTGATCTTGCA
AAGTTGCGAGTAGAGCTGGAAGGAACCAGATTGTTAGTACTAGAAGCTGCTGATCATCTCGATCAGTTTGGGAACAAAAA
AGCTAGAGGGATTCTCGCAATGGCCAAGGTTGCAGCTCCAAACATGGCGTTGAAGGTACTAGACACGGCTATTCAAGTTC
ATGGAGCAGCTGGTGTGTGCTCGGATACAGTTTTGGCACATCTGTGGGCAACTGCTAGAACGCTCAGGATTGCTGATGGA
CCTGACGAGGTTCATCTTGGGACCATTGGCAAGTTAGAGTTACAGAGAGCTTCAAAGCTTTAA