Details for Chinese cabbage Locus Brara.E03253

Position : A05 ( 5`- 26358055 .. 26362589 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03253

Protein [Map View]
MASRTKGKATMEVGGDGVAVITLINPPVNSLSFDVLENLKSNYEEALSRNDVKAIVITGAKGRFSGGFDISGFGDIQKGT
RKAPKPGYISIDIITDLLEAAKKPSVAAIDGLALGGGLELAMACHARISTPGAQLGLPELQLGVIPGFGGTQRLPRLVGL
TKALEMILTSKPVKAEQGHSLGLVDAVVPPAELLNAARRWALDIAERRKPWVSSVLKTDKLPPLGEAREILKFAKDQTRR
QAPNLKHPLMCLEAVEVGIVSGSRAGLEKEALISSQVVKLDTTKSLIHVFFSQRGTTKVPGVTDRGLVPRKIKKVAIIGG
GLMGSGIATALILSNYPVILKEVNEKFLEAGVGRVKANLQSSVKKGRMSQEKFEKTMSLLKGSLDYESFRDVDMVIEAVI
ENISLKQQIFADLEKYCPQHCILASNTSTIDLNKIGERTKSQDRIIGAHFFSPAHVMPLLEIVRTNRTSAQVIVDLLDVG
KKIKKTPVVVGNCTGFAVNRMFFPYTQAAMFLVERGTDPYLIDKAVSKFGMPMGPFRLCDLVGFGVAIATATQFIENFPE
RTNKSMIIPLMQEDKRAGEATRKGFYLYDEKRKAKPDPELKKYIEKARSVSGVNLDPKLAKLTEKEIIEMTFFPVVNEAC
RVFAEGIAVKAADLDIAGIFGMGFPPYRGGIMFWADSIGSKYIYSKLDEWSKAYGGFFKPCDFLAERGSKGAPLSAPLEQ
ARSRL*

DNA
ATGGCGTCACGAACGAAGGGAAAGGCAACGATGGAAGTTGGAGGCGATGGCGTCGCCGTCATAACGCTCATCAACCCTCC
CGTCAATTCCCTATCATTCGACGTGCTAGAGAACCTTAAAAGTAATTACGAGGAGGCCTTGAGCAGGAATGATGTTAAAG
CTATTGTTATTACAGGTGCCAAGGGGAGGTTCTCTGGTGGATTTGATATATCTGGTTTTGGTGATATTCAGAAAGGGACA
AGAAAAGCGCCAAAGCCTGGATACATATCAATAGACATCATCACTGATTTGCTTGAAGCTGCAAAGAAACCGTCTGTAGC
TGCCATTGATGGGCTTGCCTTGGGAGGAGGGTTAGAGCTCGCCATGGCGTGCCATGCAAGGATATCAACCCCTGGTGCAC
AGTTAGGTCTGCCTGAGCTGCAACTCGGTGTTATTCCTGGGTTTGGAGGAACACAGCGTCTTCCACGTCTTGTTGGTCTT
ACAAAAGCCCTTGAGATGATTTTGACATCTAAGCCGGTTAAAGCTGAGCAAGGTCATTCATTGGGTCTTGTTGATGCTGT
CGTGCCACCTGCCGAGTTACTAAACGCTGCTCGTCGCTGGGCTCTTGACATAGCCGAGAGAAGAAAACCATGGGTTTCTA
GTGTTTTAAAGACTGATAAGTTGCCTCCTCTTGGAGAGGCAAGGGAGATACTGAAGTTTGCCAAGGATCAGACACGCAGG
CAAGCCCCCAACCTGAAACACCCCTTAATGTGCCTTGAGGCTGTTGAAGTGGGTATTGTTTCTGGTTCTAGGGCTGGTTT
AGAAAAGGAGGCCCTAATCTCCTCACAAGTGGTCAAGCTGGATACCACCAAAAGCTTGATCCATGTCTTCTTTTCTCAGC
GAGGAACTACAAAGGTTCCTGGAGTTACTGATCGTGGGTTGGTGCCAAGGAAGATTAAAAAGGTAGCCATAATCGGAGGC
GGGTTAATGGGATCTGGAATAGCCACTGCATTGATCCTCAGCAACTATCCAGTGATTCTCAAGGAGGTCAATGAGAAGTT
CTTGGAGGCTGGAGTTGGCAGGGTCAAAGCTAATCTTCAGAGTAGTGTAAAGAAAGGAAGGATGTCTCAGGAAAAGTTTG
AGAAAACCATGTCACTCCTTAAAGGTTCTCTTGACTATGAAAGCTTTAGGGATGTGGACATGGTCATCGAGGCTGTCATT
GAGAATATATCTTTGAAACAGCAAATTTTTGCTGATCTAGAGAAGTACTGTCCTCAACATTGTATCCTTGCTAGCAACAC
ATCTACCATTGATCTGAACAAAATTGGGGAGCGGACCAAGTCCCAGGATCGGATTATTGGAGCACATTTTTTCAGTCCGG
CACATGTGATGCCACTACTCGAAATAGTTCGGACCAATCGTACATCTGCCCAAGTAATTGTTGACCTGTTAGATGTTGGG
AAGAAGATCAAGAAAACGCCAGTGGTGGTGGGAAACTGCACAGGGTTTGCAGTTAACAGGATGTTCTTTCCATACACACA
GGCAGCTATGTTCCTTGTTGAACGTGGAACAGATCCATATCTGATTGACAAGGCAGTCAGCAAGTTTGGAATGCCAATGG
GTCCCTTCAGATTGTGCGATTTGGTTGGATTCGGTGTGGCGATTGCAACCGCTACGCAATTCATCGAGAACTTTCCAGAA
AGGACAAACAAATCAATGATTATCCCACTCATGCAAGAGGACAAGAGAGCTGGTGAAGCCACTCGTAAAGGTTTCTATCT
TTATGATGAAAAGCGAAAGGCTAAACCTGATCCTGAACTAAAGAAGTATATCGAGAAGGCAAGGAGCGTATCAGGAGTGA
ACCTTGACCCTAAGCTGGCGAAACTTACGGAAAAGGAGATTATTGAAATGACGTTTTTCCCAGTAGTGAACGAGGCGTGT
AGAGTTTTTGCGGAAGGGATTGCTGTCAAAGCAGCAGACCTTGACATCGCTGGCATATTTGGAATGGGGTTTCCACCTTA
CAGAGGAGGAATCATGTTCTGGGCTGATTCCATTGGATCGAAATACATTTACTCAAAGCTGGATGAGTGGTCGAAGGCTT
ATGGTGGTTTCTTCAAGCCTTGTGATTTCTTGGCTGAAAGGGGATCTAAAGGAGCTCCTCTGAGCGCTCCCTTGGAACAA
GCCAGATCGCGGTTGTAA