Details for Chinese cabbage Locus Brara.E03252

Position : A05 ( 5`- 26354585 .. 26355664 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03252

Protein [Map View]
MVDLKDQDMGDGMQCTTHPYTKNPGGICPLCLQEKLGKLVTSSFPLPKPNHLSASSSSKSFSPSSTTTSLALSLSSGRDS
NNNNNNNSLPFLLAKKKSMLAAASSSSSSSSASLIYKRSKSSAAAYGESLNRKKRSGFWSFLHLYSSKHQIAAATKKVSH
PSVPRNQTTETSNKVVGGGIDVIKEEEDESSSSNKGVVETPANGVGSGAGGSSLERKVLRSRSVGCGSRSFSGDFFERIS
NGFGDCALKRIESQREHSKVISNGGGGEAADAMNEMVKCGGIFGGFMIMTSSSSSSTSASSTVDHHHHKMGNKSAWGRAF
ASPMRAKTVHKGGTTTESSTDKNTTQNLDSVSSLVTMRS*

DNA
ATGGTGGACCTCAAAGATCAAGACATGGGAGATGGGATGCAATGCACAACACATCCTTACACAAAGAACCCTGGTGGTAT
CTGTCCACTATGTCTCCAAGAAAAGCTCGGTAAGCTCGTCACTTCCTCTTTCCCTCTCCCTAAACCAAACCACCTCTCTG
CTTCCTCTTCTTCTAAATCCTTCTCTCCTTCTTCCACCACCACCTCTCTTGCTCTGTCACTCTCATCTGGAAGAGACAGC
AACAACAACAATAACAACAACAGCCTCCCGTTTCTTCTTGCCAAGAAGAAGAGTATGCTCGCAGCTGCTTCTTCATCCTC
TTCCTCTTCTTCGGCTAGTCTTATCTACAAGAGAAGCAAATCTTCGGCTGCTGCTTACGGTGAGAGTTTAAACCGCAAGA
AACGAAGTGGCTTCTGGTCGTTTCTTCATCTCTACTCTTCCAAACACCAAATAGCCGCCGCCACAAAAAAAGTTAGCCAT
CCTTCGGTGCCAAGAAACCAGACAACAGAGACATCTAACAAGGTTGTTGGTGGAGGCATTGATGTGATAAAGGAGGAAGA
AGATGAGAGCTCTAGTAGTAACAAAGGTGTTGTAGAGACGCCAGCTAACGGTGTTGGTAGTGGTGCTGGTGGGTCGTCTT
TAGAGAGGAAAGTGTTGAGATCTAGATCTGTAGGGTGTGGAAGCAGAAGCTTCTCTGGTGATTTCTTTGAGAGGATCTCT
AACGGGTTTGGAGATTGTGCCTTGAAAAGGATTGAGTCACAAAGAGAACACTCAAAGGTTATTAGTAATGGTGGTGGTGG
TGAAGCAGCTGATGCTATGAATGAAATGGTGAAATGTGGTGGTATCTTTGGTGGGTTTATGATTATGACATCATCATCAT
CATCATCAACTTCAGCATCATCAACGGTTGATCATCATCATCATAAGATGGGGAATAAAAGCGCATGGGGAAGGGCGTTT
GCAAGTCCAATGAGAGCCAAGACTGTTCATAAAGGTGGTACTACTACAGAGTCATCAACTGATAAAAACACAACTCAAAA
CTTGGACTCAGTTTCTTCGTTGGTTACTATGAGAAGTTAA