Details for Chinese cabbage Locus Brara.E03250

Position : A05 ( 5`- 26348477 .. 26351628 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03250

Protein [Map View]
MESSPLKKLEQLEFSLDSVTDLSSSPSASPSSPAVATFSCVDGVTELRFLQSDSTHCFTFDLASAQLFKLGTVQFICVSD
DNSEEERSFSKGVNIKFGSEKDSKEFCDSFEEWRKDALVHGSSTVSASKSKFDDKIEASSAKMYFHYYGQLLHQQNMLQD
YVRTGTYYAAVMENRSDFAGRVVVDVGAGSGILSMFAAQAGAKHVYAVEASEMAEYARKLIAGNPLFADRITVIKGKVED
IELPEKADILISEPMGTLLVNERMLESYVIARDRFMSPNGKMFPTVGRIHMAPFSDEFLFIEMANKALFWQQQNYYGVDL
TPLFGSAHQGYFSQPVVDAFDPRLLVAPPTFHTIDFTQMKEEDFYEIDIPLKFTSSVCTRVHGLACWFDVLFDGSTVQRW
LTTAPGAPTTHWYQIRCVLAQPIYVMAGQEITGRLHLVAHSAQSYTIDLTLSAKMWGPGASQGGILQSSTGKFDLKEPYY
RMSQPQAYPAAQEPPLPPQPQLNPQDIQIQSDDFEEELLQEPAQNASTTQL*

DNA
ATGGAGTCCTCTCCTTTGAAAAAGCTCGAGCAGCTAGAGTTCTCTCTAGATTCCGTCACTGATCTCTCCTCCTCCCCTTC
CGCTTCGCCTTCCTCTCCCGCCGTAGCTACGTTCTCGTGCGTTGACGGCGTCACGGAGCTCCGGTTTCTCCAATCGGACT
CGACCCATTGTTTCACTTTTGATCTCGCTTCAGCTCAGTTATTCAAGTTGGGGACAGTCCAGTTCATATGTGTATCTGAT
GATAACTCAGAGGAGGAGAGATCGTTCTCTAAAGGAGTTAATATAAAGTTTGGAAGTGAGAAGGATAGCAAAGAGTTTTG
TGATTCATTCGAGGAGTGGAGAAAGGATGCTCTTGTTCATGGATCATCCACAGTTTCAGCTAGTAAAAGCAAGTTTGACG
ATAAGATTGAGGCGTCCTCTGCCAAAATGTATTTCCATTACTATGGACAACTTCTACATCAGCAAAACATGCTGCAAGAT
TATGTCAGGACAGGTACATATTATGCTGCGGTGATGGAGAACCGTTCAGATTTTGCTGGTCGTGTTGTGGTCGATGTGGG
TGCTGGGAGTGGCATTTTGTCTATGTTTGCTGCCCAGGCTGGTGCCAAGCATGTGTATGCTGTAGAAGCATCAGAAATGG
CTGAGTATGCACGTAAGCTGATCGCTGGTAACCCCTTGTTCGCTGATCGAATCACAGTCATCAAGGGAAAGGTCGAGGAT
ATTGAGTTGCCTGAGAAAGCGGATATTTTAATCTCTGAACCAATGGGCACCTTATTGGTCAATGAGAGAATGTTGGAATC
GTATGTAATTGCTAGGGATCGTTTCATGTCTCCGAATGGCAAAATGTTTCCCACTGTTGGAAGGATTCACATGGCACCTT
TCTCGGATGAGTTTTTGTTTATTGAAATGGCAAATAAGGCTTTGTTTTGGCAACAACAGAACTATTATGGAGTTGATTTG
ACACCTCTGTTTGGTTCAGCACACCAAGGTTATTTTTCTCAGCCTGTGGTTGATGCATTTGATCCGAGGTTACTGGTTGC
TCCCCCTACGTTTCATACGATAGATTTCACTCAGATGAAGGAAGAAGATTTTTATGAGATTGATATCCCATTGAAGTTTA
CTTCTTCCGTATGCACCCGAGTGCATGGACTTGCCTGCTGGTTCGACGTACTCTTTGACGGGAGCACGGTACAAAGATGG
CTCACAACTGCTCCTGGTGCGCCTACAACGCATTGGTACCAGATCAGATGTGTTCTGGCACAACCCATTTATGTGATGGC
AGGTCAAGAGATCACTGGTAGACTTCATTTGGTAGCTCACAGTGCTCAGAGTTACACCATTGATCTAACTCTATCAGCTA
AAATGTGGGGTCCTGGTGCAAGTCAAGGAGGAATCCTCCAATCATCGACAGGCAAATTCGATCTGAAGGAACCTTACTAT
AGAATGTCTCAGCCACAAGCATACCCTGCTGCACAAGAGCCACCATTACCACCACAACCGCAGCTAAACCCACAGGACAT
ACAGATACAGAGCGATGATTTTGAAGAAGAGTTATTACAAGAACCGGCACAGAACGCGAGTACCACCCAGCTATAA