Details for Chinese cabbage Locus Brara.E03249

Position : A05 ( 5`- 26341021 .. 26343124 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03249

Protein [Map View]
MSQPNNNNGDDDKKYKKIFVGGLAWSVTTDVLRSFFQEKCGEEVLEANVVSETLPDGNLKSKGYGFVTFRDVAAATRACR
PPYPDIEGRRTNINLAYVNAKNNPNQTGWFNQVAWQQYPQFCTNPQFPQVYWDSYRGAYFQIPHHPCSSNMNWHQTHSLR
PPGMSQPPTEPRFEELPADTNQEAVSTPDGVRNDNNEEVDTETDSGVDQQNGKDQDGEISGQDNGIKLDVKDQEGEINGQ
NNGIKQDVKDQEGEINGQDNGIKQDVKDEEGKIVSGEDENTKQGAGVTNQFCSAINVTLQIETGREEKSENTPQENGFDH
EEKTQHMEVGLITKETDKNA*

DNA
ATGTCTCAGCCAAACAATAACAATGGTGATGATGATAAAAAATACAAGAAGATCTTCGTTGGAGGTTTAGCATGGAGCGT
AACAACAGATGTTTTGAGAAGTTTCTTCCAAGAAAAGTGTGGAGAGGAGGTTCTTGAAGCTAATGTTGTCAGCGAGACTC
TCCCTGATGGTAACTTGAAATCAAAAGGCTATGGTTTTGTTACTTTTAGGGATGTTGCAGCTGCAACTAGAGCTTGTCGA
CCTCCGTATCCGGATATTGAGGGAAGAAGAACCAACATCAATCTGGCTTACGTTAATGCAAAGAATAACCCTAACCAAAC
TGGTTGGTTTAATCAGGTGGCCTGGCAACAATATCCGCAATTTTGTACAAATCCACAGTTTCCTCAAGTCTACTGGGATT
CATATCGTGGAGCATATTTTCAAATTCCACACCATCCTTGCTCCTCCAACATGAACTGGCATCAGACCCACAGTTTACGA
CCTCCCGGTATGTCTCAGCCGCCTACAGAACCAAGATTTGAAGAGCTCCCTGCTGATACCAATCAAGAAGCTGTCTCCAC
TCCAGATGGTGTGCGCAATGACAACAATGAAGAGGTCGATACAGAAACAGACAGTGGTGTCGATCAGCAAAATGGAAAGG
ATCAGGATGGAGAGATTAGTGGACAAGACAATGGCATCAAGCTAGATGTTAAGGATCAAGAAGGAGAGATCAATGGACAA
AACAATGGCATCAAGCAAGATGTTAAGGATCAAGAAGGAGAGATCAATGGACAAGACAATGGCATCAAGCAAGATGTTAA
GGATGAAGAGGGAAAGATCGTGAGTGGAGAAGATGAAAACACCAAGCAGGGTGCAGGTGTGACAAATCAGTTTTGTTCTG
CGATCAATGTTACACTCCAAATCGAGACAGGCCGTGAAGAAAAATCTGAAAACACACCACAAGAAAACGGTTTTGATCAC
GAAGAGAAGACGCAGCATATGGAAGTTGGACTGATCACAAAGGAGACTGACAAGAATGCATGA