Details for Chinese cabbage Locus Brara.E03248

Position : A05 ( 5`- 26337532 .. 26340789 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03248

Protein [Map View]
MLARAPPPSVTFPARSKVCNRREIVRLFRYGGGTRAGFTRSCSNEVVSDSTDDGFIVIKAEHHEKELYPPPPSDLASSIP
SESSRRDGSRSRGVTASFGRLKAQKVKALVGKVTQKKQQVSRNEEEEDEDDDVFEDEEFGGSSILDLMRKKLAMKDLPSS
GKSSEVKRFSRVQESREQRDRDRSQTNERDSNGYAANSRGRGDRPSLAKDLDTFKGRDRAVGEVSKFSDNERAGSRSSYS
KDSAANSRGREDRRFVNKESDTYQRRDRATTDEFSDSRYFNDNERGGSYSSYSRASAGNSRGWGDRRSVVYARDIEDWRE
RGNRTKATRETGFFSRKSFAEVGCSEDMTKALKENNFDRPAHIQALAFAPVVDGKSCIIADQSGSGKTLAYLVPVIQRLR
EEELQGLSKSSSGCPRVIVLVPTAELASQVLANCRLISKSGVPFRSMVVTGGFKQRTQLENLEQGVDVLIATPGRFTYLM
NEGMLGLSNLRCAILDEVDILFGDEEFESALQNLISSSPVTAQYLFVTATLPLEIYNKLVEVFPDCEVVMGPRVHRVSNS
LEEVLVDCSGDDNAEKTPETAFQNKKAALLQIIEENPVAKTIIFCNKIETCRKVENIFKRLDRNERQLHVLPFHAALAQG
ARLTNMEEFTSSHPENHSLFLVCTDRASRGIDFSGVDHVVLFDFPRDPSEYVRRVGRTARGARGEGKAFVFVVGKQVTLA
RRIIERNQKGHPVHDVPNAYEFTT*

DNA
ATGTTGGCGAGAGCTCCACCTCCGTCAGTTACTTTTCCGGCGAGGAGTAAAGTTTGTAATCGGAGAGAGATTGTGCGGCT
GTTTCGTTACGGCGGAGGAACGAGAGCCGGATTCACTCGTTCATGCTCGAATGAGGTCGTTAGCGACTCCACCGATGATG
GATTCATCGTAATCAAAGCTGAACACCACGAGAAGGAGCTCTATCCTCCGCCTCCGTCCGATTTAGCCTCCTCGATTCCG
TCAGAATCTTCGAGAAGAGATGGTTCGCGTTCGAGAGGAGTAACCGCGAGCTTCGGAAGGCTAAAGGCGCAGAAAGTGAA
AGCTCTTGTTGGTAAGGTAACGCAGAAGAAGCAGCAAGTGAGTCGTAATGAGGAAGAAGAAGACGAGGATGATGATGTTT
TTGAGGATGAAGAGTTTGGTGGATCATCAATTCTTGATTTGATGAGGAAGAAGTTGGCTATGAAGGACCTACCTAGTTCA
GGAAAATCTTCAGAGGTGAAAAGATTCAGCAGAGTGCAGGAATCTAGAGAGCAGAGAGATAGAGATAGATCTCAGACTAA
TGAGAGAGATTCAAACGGTTATGCTGCTAACTCCAGGGGTAGAGGAGATAGGCCTTCGCTTGCGAAAGATTTAGATACAT
TCAAGGGGCGTGACAGAGCTGTTGGTGAGGTTTCAAAGTTTAGTGATAACGAAAGAGCAGGATCGAGGAGTTCATATTCA
AAAGACTCTGCTGCTAACTCTAGGGGTAGAGAAGATAGGCGTTTTGTTAACAAAGAGTCAGATACATATCAGAGACGTGA
TAGAGCTACTACGGATGAGTTTTCAGATTCTCGGTATTTCAATGATAATGAGAGAGGAGGATCATATTCTTCATATTCAA
GAGCTTCCGCTGGTAACTCCAGGGGGTGGGGTGATAGGCGTTCTGTTGTGTACGCAAGAGATATTGAGGATTGGAGAGAG
AGAGGGAATAGAACCAAAGCTACTAGGGAGACCGGGTTCTTTAGCCGCAAAAGTTTTGCAGAGGTTGGATGCAGTGAGGA
TATGACGAAGGCCTTAAAGGAGAATAATTTTGATCGACCGGCTCATATTCAGGCTCTGGCTTTTGCGCCAGTTGTTGATG
GAAAGAGTTGTATCATAGCTGACCAAAGTGGTTCAGGCAAGACACTGGCATATCTTGTTCCTGTTATTCAGCGTCTCAGG
GAAGAGGAACTCCAAGGACTGAGCAAGTCGTCTTCTGGTTGTCCTCGTGTGATTGTTCTGGTACCAACCGCAGAGTTGGC
TTCCCAGGTTCTTGCCAACTGTAGATTAATCTCAAAGTCTGGGGTCCCGTTCCGTTCCATGGTAGTGACTGGTGGTTTCA
AACAACGAACCCAGCTCGAAAATTTAGAGCAAGGTGTGGACGTTTTGATTGCAACACCAGGGCGTTTCACGTACCTTATG
AATGAAGGAATGTTGGGGCTGTCAAATTTGAGATGTGCCATATTAGATGAGGTGGATATACTCTTTGGCGACGAGGAGTT
TGAGTCAGCCCTGCAGAATCTGATCAGTTCTTCCCCTGTGACTGCGCAATATCTGTTTGTTACGGCAACCCTGCCCCTTG
AGATATACAACAAACTTGTTGAAGTTTTCCCTGATTGTGAAGTTGTAATGGGACCTCGCGTGCACCGTGTTAGCAATTCC
CTCGAAGAGGTTCTAGTTGACTGCAGTGGAGATGATAATGCAGAGAAAACTCCTGAAACTGCTTTTCAGAACAAGAAAGC
TGCTCTACTTCAGATTATCGAGGAGAACCCTGTTGCCAAGACTATCATCTTTTGCAATAAGATTGAGACATGTAGGAAAG
TTGAGAACATATTCAAGCGGCTTGATAGAAACGAAAGGCAGCTGCACGTGCTACCGTTTCACGCAGCACTCGCACAAGGT
GCAAGGCTTACAAACATGGAAGAGTTCACCTCATCTCATCCCGAAAATCATTCACTGTTTCTGGTCTGCACGGATAGAGC
TTCTCGTGGGATAGATTTCTCCGGTGTTGATCACGTGGTGCTGTTTGATTTTCCGCGTGACCCGAGTGAATACGTAAGAC
GTGTTGGAAGAACAGCGAGAGGGGCTAGAGGAGAAGGAAAGGCTTTCGTCTTTGTGGTGGGGAAACAAGTAACGTTGGCA
CGGAGGATCATTGAGAGGAATCAGAAGGGTCATCCGGTGCATGATGTCCCAAACGCTTATGAGTTCACAACTTGA