Details for Chinese cabbage Locus Brara.E03246

Position : A05 ( 5`- 26311543 .. 26311873 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03246

Protein [Map View]
MKTNCKIGFMSLIMIASVLIILFMVPEKVEADGQCIGRCGMIFDCATACIRMGYQSGQCVGWKNPN*

DNA
ATGAAGACGAATTGCAAGATTGGATTCATGAGCTTAATAATGATTGCTTCTGTACTCATCATATTATTCATGGTTCCAGA
AAAAGTTGAAGCCGACGGACAATGCATTGGACGGTGTGGAATGATTTTTGACTGTGCGACTGCTTGCATCAGGATGGGAT
ACCAATCTGGCCAATGTGTTGGCTGGAAAAATCCGAATTAG