Details for Chinese cabbage Locus Brara.E03244

Position : A05 ( 5`- 26300722 .. 26304565 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03244

Protein [Map View]
MPPETSPAKLGRASSSSSSSSSSSSDRASVKIEEIEDGGSSSGVVVVNGSEVVETKLESAVTDDNAVAESSGGGSKSFAR
VWTMPVEGSSSSDKAESSSSASKPRLDKSKTERQQQKEKVTHILAEDAAKIFDDRLSAGKKLKLLNRIATVKHDGTVEFE
VPADVIPQPIAVDREEDSKNGVCPDESIDGVDLQYIPPMQIVMLIVGTRGDVQPFVAIAKRLQDYGHRVRLATHANFKDF
VLTAGLEFYPLGGDPKVLAEYMVKNKGFLPSGPSEIPVQRNQMKDIINSLLPACKEPDPDSGISFKADAIIANPPAYGHT
HVAEALRIPIHVFFTMPWTPTSEFPHPLSRVKQPAGYRLSYQIVDSLIWLGIRDMINDLRKKKLKLRPVTYLSGTQSSGS
NIPYGYMWSPHLVPKPKDWGPQIDVVGFCFLDLASNYEPPAELVEWLEAGDKPIYIGFGSLPVQEPETMTEIIVEALQRT
KQRGIINKGWGGLGNLKEPKDFVYLLDNVPHDWLFPRCKAVVHHGGAGTTAAGLKAACPTTIVPFFGDQPFWGERVHARG
VGPAPIPVDEFSLHKLEDAINFMLDDKVKSSAETLAKAMKDEDGVAGAVKAFFKHLPSMRQNVSDPIPEPSSFLSFRRCF
GCS*

DNA
ATGCCGCCGGAAACATCGCCGGCCAAACTCGGCAGAGCTTCTTCCTCCTCTTCTTCATCCTCATCTTCAAGCTCAGACCG
CGCTTCCGTCAAAATCGAGGAGATTGAAGACGGAGGTAGTAGCAGCGGCGTCGTCGTCGTCAATGGCTCTGAAGTAGTGG
AGACCAAACTAGAGTCTGCTGTTACCGACGACAACGCAGTGGCTGAATCTTCAGGTGGTGGGAGTAAAAGCTTTGCTAGA
GTATGGACAATGCCTGTGGAAGGTTCTTCGAGTAGCGATAAAGCTGAATCATCATCATCAGCGTCAAAGCCTAGGTTAGA
TAAATCAAAGACTGAGAGGCAACAGCAGAAAGAGAAAGTTACTCACATTCTCGCCGAGGACGCAGCTAAGATTTTCGATG
ACAGACTCTCTGCAGGGAAGAAGCTGAAATTGTTGAACCGTATAGCTACGGTGAAACATGATGGGACTGTTGAGTTTGAA
GTTCCGGCAGATGTTATCCCACAGCCTATTGCTGTAGACCGTGAAGAAGATTCCAAAAACGGTGTTTGTCCTGATGAGTC
TATCGATGGGGTTGATCTTCAGTATATCCCTCCTATGCAGATTGTGATGCTGATCGTTGGAACGCGTGGTGATGTTCAGC
CTTTTGTTGCAATAGCCAAACGCCTTCAGGACTATGGGCATAGAGTTAGGCTTGCAACTCATGCGAATTTCAAAGATTTT
GTTTTGACTGCTGGTTTGGAGTTTTATCCTTTAGGTGGAGATCCAAAAGTGCTAGCTGAGTATATGGTTAAGAACAAGGG
GTTTTTACCATCAGGCCCTTCAGAGATTCCGGTTCAACGAAACCAAATGAAGGACATCATAAACTCTCTGCTTCCAGCTT
GTAAAGAACCTGATCCAGATTCTGGCATCTCCTTTAAAGCCGACGCAATTATCGCCAATCCTCCAGCATATGGACATACA
CATGTGGCAGAAGCACTAAGGATACCGATTCATGTATTTTTCACCATGCCTTGGACGCCAACCAGTGAGTTTCCACACCC
TTTGTCACGTGTCAAACAACCAGCAGGATACAGACTTTCGTATCAAATCGTGGATTCATTGATCTGGCTTGGAATAAGGG
ACATGATAAACGACCTTAGGAAAAAGAAATTGAAGCTAAGGCCCGTTACATATCTAAGTGGAACACAAAGCTCTGGCTCT
AACATTCCATATGGATATATGTGGAGTCCTCATCTAGTCCCAAAGCCCAAAGACTGGGGGCCACAAATAGATGTAGTGGG
ATTCTGCTTCCTTGATCTTGCGTCAAACTATGAACCTCCTGCAGAACTTGTGGAATGGTTAGAAGCTGGTGACAAACCTA
TTTACATCGGCTTTGGTAGTCTGCCTGTCCAAGAACCAGAGACGATGACTGAAATAATTGTGGAAGCACTTCAAAGAACC
AAACAGAGAGGAATCATCAACAAAGGCTGGGGTGGCCTTGGAAACTTGAAAGAACCGAAGGATTTTGTTTACTTGTTGGA
TAATGTCCCTCATGACTGGTTATTCCCGAGATGCAAGGCAGTGGTTCATCATGGAGGTGCTGGGACAACGGCTGCAGGTC
TTAAAGCAGCGTGCCCAACTACAATAGTGCCTTTCTTTGGAGACCAACCTTTCTGGGGAGAACGAGTGCACGCTAGAGGA
GTAGGTCCTGCACCAATCCCAGTAGATGAATTCTCACTCCATAAGCTTGAAGATGCCATTAATTTCATGCTTGACGATAA
GGTGAAGAGCAGTGCAGAGACACTAGCAAAGGCGATGAAGGACGAGGATGGTGTGGCTGGAGCTGTGAAGGCCTTCTTCA
AACATCTTCCGAGTATGAGACAGAATGTTTCGGATCCTATCCCTGAACCATCGAGCTTCCTATCGTTTAGAAGATGCTTT
GGCTGTTCGTAA