Details for Chinese cabbage Locus Brara.E03236

Position : A05 ( 5`- 26270663 .. 26273105 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03236

Protein [Map View]
MTFHDYSITFLRLSLLCFLSPAASSADYIPSTLDGPFVPVTVPLDTSLRGKAIDLADTDPRVRRHVTGFEPEQISLSLSS
DYDSIWVSWITGEFQIGKNVKPLDPTSIDSIVQFGTLRHSLSHEAKGTSLVYSQLYPFDGLLNYTSGIIHHVRITGLKPS
TVYYYRCGDPSRHAMSKIHHFRTMPVSSPSSYPSRIAVVGDLGLTYNTTDTVSHLLQNSPDLVLLIGDVSYANLYLTNGT
SSDCYSCSFSDTPIHETYQPRWDYWGRFMETLTSKVPLMVVEGNHEIELQAENKTFEAYKSRFAFPFKESGSSSKLYYSF
NAGGIHFVMLGAYIAFEKPGEQYEWLKKDLAKFDRSVTPWLVVSWHPPWYSTYTAHYREAECMKEAMEELLYSYGTDIVF
NGHVHAYERTNRVYNYELDPCGPVYIVVGDGGNREKMAIEHADEPGKCPDPLTTPDPAMGGEFCGWNFTTTGKFCWDQQP
EYSALRESSFGHGILEVKNETWALWTWYRNQDSSSKVGDQIYIVREPDRCHGYNRLVDHC*

DNA
ATGACGTTTCATGACTATTCTATAACTTTCCTCAGACTCTCACTTCTTTGCTTTCTTTCGCCGGCAGCCTCCTCCGCCGA
TTATATCCCGTCAACGTTAGACGGACCGTTCGTACCGGTGACGGTTCCGTTAGACACATCTCTCCGAGGAAAGGCAATCG
ATTTGGCTGACACCGATCCTCGTGTCCGCCGCCACGTCACCGGCTTCGAGCCGGAGCAGATTTCTCTGTCTCTTTCCTCC
GATTACGACTCCATATGGGTCTCTTGGATCACAGGTGAGTTCCAAATCGGAAAGAACGTGAAGCCATTAGATCCGACAAG
TATCGACAGTATTGTCCAGTTCGGTACTTTGAGACACTCACTGAGTCACGAAGCCAAAGGAACATCACTTGTTTATAGTC
AACTTTACCCTTTTGACGGTCTCTTAAACTATACTTCTGGAATCATACACCATGTTCGCATTACAGGGCTGAAACCAAGT
ACTGTCTATTACTACCGATGCGGCGATCCTTCACGACACGCTATGAGTAAGATACACCATTTCAGGACAATGCCTGTTTC
TAGCCCCTCGAGTTACCCTAGCCGAATAGCAGTTGTGGGTGATCTTGGTCTCACTTACAACACAACAGATACAGTTAGCC
ATTTGCTTCAGAACTCTCCGGATCTTGTTTTACTGATCGGCGACGTGAGCTACGCGAACTTGTACCTAACGAACGGGACT
AGCTCAGATTGTTACTCTTGCTCTTTCTCGGATACGCCTATACACGAGACGTATCAGCCGCGTTGGGACTATTGGGGTAG
ATTTATGGAGACACTGACTTCGAAAGTCCCTTTGATGGTGGTCGAAGGAAACCACGAGATCGAGTTGCAAGCCGAGAACA
AGACGTTCGAAGCTTATAAGTCAAGATTTGCTTTTCCATTTAAAGAAAGCGGCTCTTCTTCTAAGCTTTATTATTCTTTT
AACGCCGGTGGGATCCACTTTGTAATGCTCGGTGCCTACATCGCCTTTGAGAAGCCAGGCGAGCAATACGAGTGGCTAAA
GAAGGATCTGGCTAAGTTTGATAGATCGGTGACTCCGTGGTTGGTGGTTTCTTGGCATCCGCCTTGGTATAGCACTTACA
CGGCGCATTACAGAGAGGCTGAGTGTATGAAAGAAGCTATGGAGGAGTTGCTTTACTCTTACGGTACCGACATTGTCTTC
AACGGACATGTCCATGCTTATGAACGGACGAACAGAGTTTACAACTACGAACTAGACCCATGCGGTCCAGTTTACATAGT
GGTAGGTGATGGAGGAAACCGCGAAAAGATGGCGATCGAGCACGCCGATGAACCCGGTAAATGCCCTGACCCATTAACCA
CGCCGGATCCAGCCATGGGTGGGGAGTTTTGCGGTTGGAACTTCACCACGACTGGTAAGTTCTGTTGGGATCAGCAGCCT
GAGTATAGTGCATTGAGAGAAAGCAGCTTCGGCCATGGAATATTAGAGGTGAAGAACGAGACATGGGCACTATGGACATG
GTATAGGAACCAAGACTCGAGTAGTAAAGTTGGAGATCAGATTTATATTGTGAGAGAACCTGATCGATGTCATGGTTACA
ACCGTCTTGTTGACCATTGTTAA