Details for Chinese cabbage Locus Brara.E03235

Position : A05 ( 5`- 26266463 .. 26269811 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03235

Protein [Map View]
MARTVLTWWIPLLILQSFLLAIAFGSNEVEEEFSESLLLKPLPDRKVLAHFHFENRAPPSNSHGRHHHLFPKAISQLVQK
FRVKEMELSFTQGRWNHEHWGGFDSLSSMNAKPVGVELWAVFDVPHSQVDTSWKNLTHALSGLFCASINFLESSTSYAAP
TWGFGRSADKLRYGSLPREAVCTENLTPWLKLLPCRDKDGISALMNRPSVYRGFYHSQRLHLSMVDSGEEGLGSGMLLEQ
SLTVVLQPDTVYDGKDLQPSWSLSSLFGRKVVGKCVLAKSSNVYLQMEGLAHQALWKNEEFELSTQPDRILRENSSFLYI
FNIDKSSDSEPFDLGLTWKLPSKWSCQQAPLHASRFLMGSGNERGAIAILLKATESQDKLSGRDLTNGGRCTIRANVFQI
FPWYVKVYYHTLQIFVDQQQNTSGEVLKKINVSPSTDKMSSGMMEMMLELPCEVKSAAISIEYDKGFLHIDEYPPDANQG
FDIPSALISFPDHHASLDFKEELSTLPLLSKFKDKSLVRSYTEVLLVPLTTPDFSMPYNVITITCTVFALYFGSLLNALR
RRIGEEERFLKSKGKKTGGLKQLLSRFTAKIRGRPAESPSSQSTAAAQSSVLSSKLLFKIILVAGVAATWQYFSTDK*

DNA
ATGGCTAGAACCGTTCTCACCTGGTGGATCCCTTTGTTAATTCTGCAATCGTTTCTGCTCGCCATCGCCTTCGGATCGAA
CGAAGTAGAAGAAGAGTTCAGCGAGTCGCTGCTGTTGAAGCCTCTCCCCGATCGGAAAGTTCTAGCTCATTTCCATTTCG
AGAATCGAGCTCCTCCGTCGAACTCCCATGGCCGCCACCACCATCTCTTCCCCAAAGCTATTTCTCAGCTGGTTCAGAAG
TTTCGAGTCAAGGAGATGGAGCTATCTTTCACTCAAGGACGTTGGAACCATGAACACTGGGGAGGATTTGATTCATTATC
AAGTATGAACGCGAAGCCTGTTGGTGTTGAGCTTTGGGCTGTGTTTGATGTTCCTCACTCTCAGGTTGATACTTCTTGGA
AGAACTTAACACACGCGCTCTCAGGGCTTTTCTGTGCTTCCATCAACTTTCTCGAATCTTCGACTTCGTATGCTGCTCCT
ACGTGGGGGTTCGGGAGAAGCGCAGACAAGCTGAGGTATGGTTCGCTGCCGCGTGAAGCTGTTTGTACTGAGAATTTGAC
GCCGTGGCTGAAGCTGCTTCCGTGTAGAGACAAGGATGGGATCTCTGCGTTGATGAATAGGCCGTCTGTTTATAGAGGGT
TTTATCATTCTCAGAGATTGCATTTATCTATGGTTGATTCTGGTGAAGAGGGGTTGGGTTCTGGGATGTTGCTTGAGCAG
AGTCTTACTGTTGTTCTTCAGCCTGACACTGTTTATGATGGGAAAGATCTACAGCCAAGTTGGTCACTTAGTTCACTCTT
TGGGAGAAAAGTTGTCGGAAAATGTGTTCTTGCAAAGTCAAGTAATGTATATCTTCAAATGGAGGGTCTTGCGCATCAAG
CACTCTGGAAGAATGAAGAATTTGAATTGTCCACACAGCCAGATAGGATTCTCCGAGAAAACAGCAGCTTTCTTTATATC
TTCAATATTGACAAATCCAGTGACAGTGAGCCGTTTGATCTTGGTCTTACTTGGAAGCTTCCTTCAAAATGGTCATGCCA
ACAAGCTCCATTACACGCTTCTCGGTTCTTGATGGGAAGCGGGAACGAAAGGGGTGCAATAGCCATCTTGTTAAAAGCCA
CAGAATCGCAGGATAAGTTATCCGGCAGAGATCTCACTAATGGCGGCCGATGTACAATAAGAGCTAACGTTTTCCAGATT
TTCCCGTGGTATGTTAAGGTTTATTATCACACTCTACAAATCTTTGTGGACCAACAACAGAATACAAGCGGTGAGGTCTT
AAAGAAGATCAATGTCTCACCATCTACGGATAAGATGTCATCTGGCATGATGGAGATGATGCTGGAACTACCATGTGAAG
TGAAATCTGCAGCCATATCCATAGAGTATGATAAGGGTTTTCTACATATAGATGAATATCCTCCTGATGCTAACCAAGGA
TTCGACATTCCATCGGCTTTGATAAGCTTTCCTGATCATCATGCAAGTTTGGATTTCAAAGAAGAACTAAGCACATTGCC
CTTGTTATCAAAATTTAAGGACAAGTCATTAGTGCGCTCTTACACAGAAGTATTGCTCGTACCTTTGACAACCCCTGATT
TTAGCATGCCTTACAACGTCATCACTATCACGTGCACTGTTTTCGCTTTGTACTTCGGGTCATTGCTCAATGCTCTCCGT
AGACGAATAGGTGAAGAAGAAAGGTTTCTCAAAAGCAAAGGAAAGAAAACAGGTGGGCTTAAGCAGTTGTTATCAAGATT
CACAGCCAAGATCAGAGGGAGACCAGCCGAATCACCATCATCACAGTCGACTGCAGCAGCTCAATCTTCGGTTTTGTCTA
GTAAACTTCTCTTCAAGATCATTTTGGTTGCAGGAGTTGCTGCAACATGGCAATATTTTTCCACGGATAAGTAG