Details for Chinese cabbage Locus Brara.E03231

Position : A05 ( 5`- 26246885 .. 26248768 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03231

Protein [Map View]
MYADRLESESGSRNTVKDRINGGSGDNSTRSRQVTGKRQRQDDKWEHDLFSSDKPQLSSRRRVDSRDLRLKLQKRDDGSQ
SGRGGGSGVRDLREKLSGTMTVQPKNSDPLKSKVEAAARPSMKSVATDTETEVTRKASSQVTRKKSQQAGGSVDSFLESL
GLEKYSTAFKVEEVDMDALMHMTDDDLKAMLIPMGPRKKILLALGSKR*

DNA
ATGTATGCTGATAGATTGGAGTCTGAGTCTGGAAGCAGGAACACGGTAAAGGATCGAATCAACGGCGGCTCTGGCGATAA
CTCTACTCGCTCCCGACAAGTGACTGGGAAGAGGCAAAGGCAGGACGACAAATGGGAGCATGATCTTTTCAGTAGTGACA
AACCTCAACTCTCAAGTCGTCGCAGAGTTGATTCTAGAGATCTTCGCCTGAAGCTCCAGAAGAGAGATGATGGGTCTCAA
AGCGGGCGAGGAGGTGGTTCAGGCGTGCGGGATTTACGTGAGAAGCTCTCTGGGACGATGACTGTGCAACCGAAGAACAG
TGACCCGCTGAAATCTAAAGTGGAGGCTGCTGCTAGACCAAGCATGAAGAGTGTAGCGACTGATACTGAAACGGAGGTTA
CTAGAAAAGCTTCAAGTCAAGTTACCAGGAAGAAATCACAGCAGGCTGGTGGATCGGTTGATAGCTTTCTGGAATCGTTG
GGTCTCGAGAAGTATTCGACTGCTTTTAAAGTGGAAGAGGTTGATATGGATGCTCTCATGCATATGACAGATGATGACCT
CAAGGCTATGCTTATACCAATGGGCCCAAGGAAGAAGATACTTCTTGCTTTGGGATCCAAACGCTGA