Details for Chinese cabbage Locus Brara.E03228

Position : A05 ( 5`- 26238076 .. 26239577 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03228

Protein [Map View]
MSSRSERVVTRSSRRSQQVTNVNGTQQSEQPRAGGQPPVVSGPPTIDVDAIEDDDDVVESTASAFDRAKRHKSGVSQRGP
LLVDVESGGTTRLSKNRTKRQSDQASVELNNPRKSKTVAPPVEEPKFNCPICMCPFTEEVSTKCGHIFCKKCIKLAVSVQ
AKCPTCRKRVIAKDLIRVFLPTTR*

DNA
ATGAGTTCACGGAGTGAGAGGGTAGTTACCAGAAGCTCAAGGAGGTCACAACAGGTGACCAATGTGAATGGGACACAACA
AAGTGAGCAACCAAGAGCTGGAGGACAACCTCCAGTTGTGTCTGGTCCACCGACAATCGATGTTGATGCCATTGAGGATG
ATGATGATGTTGTTGAATCAACTGCTTCTGCTTTTGATCGAGCTAAAAGACACAAGTCCGGAGTCTCACAGCGAGGACCC
TTACTAGTTGATGTAGAGTCAGGTGGTACCACTAGACTAAGCAAGAACCGCACAAAGCGTCAATCTGATCAAGCTAGTGT
TGAGCTTAACAATCCGAGAAAGTCCAAGACCGTAGCACCTCCTGTTGAGGAACCAAAGTTCAACTGCCCAATTTGTATGT
GTCCATTTACCGAGGAGGTGTCAACAAAGTGTGGTCATATCTTCTGCAAAAAATGCATAAAGCTGGCGGTGTCTGTTCAA
GCTAAATGCCCCACGTGTAGAAAAAGGGTCATTGCTAAAGACCTCATTCGAGTCTTCCTTCCTACCACCAGATGA