Details for Chinese cabbage Locus Brara.E03225

Position : A05 ( 5`- 26231454 .. 26231952 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03225

Protein [Map View]
MIYDVNSVLFKSFLSSKFSTDKRRGEDKPRDQKPKASDNKPVMNE*

DNA
ATGATTTACGATGTCAACTCCGTTCTCTTCAAATCCTTCCTGAGCTCGAAGTTCTCTACCGACAAAAGGAGAGGCGAGGA
CAAGCCAAGAGATCAGAAGCCCAAAGCCAGCGACAACAAACCTGTGATGAATGAATAA