Details for Chinese cabbage Locus Brara.E03219

Position : A05 ( 5`- 26173488 .. 26176352 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03219

Protein [Map View]
MPDVQSTVLEFVNKLRKRKIEGSQATAKCTVELLRSVISQQRVPHSNQALALIDAVKAVGEQLVAANPVELAVGNVVRRV
LHIIREEDLSLATAAMAGLDLLDGSDDDGEDDNCKGVGYSAMSAAVAAAAARSTLRPPSLQTLLEGTPESAAVPYTSSSG
ADSESKTADKSSITRKLKHDVIEGVNQLILEIAGCHEQIAEQAIEHIHQNEVILTLGSSRTVLEFLCAAKEKKRSFRVFV
AEGAPRYQGHLLAKELVARGLQTTVITDSAVFAMISRVNMVIIGAHAVMANGGVIGPVGVNMAALAAKKHAVPFVVLAGS
HKLCPLYPHNPEVLLNELRSPSELLDFGEFSDCLDFGTGSGSPLLQVVNPTFDYVPPSLVSLFITDTGGHNPSYMYRLIA
DYYSADDLVM*

DNA
ATGCCAGACGTACAATCAACGGTGTTGGAGTTTGTTAACAAGCTCAGAAAACGTAAGATCGAAGGCTCACAGGCTACAGC
CAAATGCACCGTAGAGCTACTCAGGTCAGTGATATCTCAACAGCGAGTGCCTCACTCAAACCAAGCTTTAGCTCTTATCG
ATGCTGTGAAAGCCGTCGGTGAACAACTGGTCGCTGCAAATCCTGTTGAGCTTGCGGTGGGGAATGTAGTGAGACGGGTG
TTGCATATCATAAGGGAGGAGGATCTCTCTTTAGCTACGGCAGCTATGGCTGGTTTGGACTTGCTTGATGGTAGTGATGA
CGATGGTGAAGATGATAATTGCAAAGGAGTTGGGTATTCTGCTATGTCTGCGGCGGTTGCTGCAGCTGCAGCTAGGAGTA
CGTTACGCCCTCCGTCTTTGCAAACGCTTCTCGAGGGGACTCCTGAGTCTGCGGCTGTTCCTTACACTTCGTCGTCCGGT
GCTGATTCCGAAAGCAAAACTGCGGATAAAAGTTCAATAACTCGGAAGCTGAAGCATGATGTTATAGAAGGAGTCAATCA
GCTTATCCTCGAGATTGCCGGTTGTCATGAGCAGATCGCCGAGCAAGCTATAGAGCATATACATCAAAATGAGGTGATTC
TAACCCTGGGTAGCTCAAGAACAGTACTTGAGTTTCTGTGTGCTGCAAAGGAGAAAAAGAGATCATTTCGTGTATTTGTC
GCCGAAGGTGCTCCAAGGTATCAGGGCCATCTCTTAGCAAAAGAATTGGTAGCTAGAGGTCTGCAGACCACTGTGATCAC
TGACTCTGCAGTGTTTGCTATGATATCTCGAGTGAATATGGTTATAATTGGAGCTCATGCAGTGATGGCCAATGGTGGAG
TTATAGGACCTGTTGGAGTCAACATGGCTGCCCTGGCAGCAAAAAAGCACGCAGTCCCATTTGTGGTTCTAGCCGGTAGT
CACAAGCTATGTCCACTCTATCCTCACAATCCGGAGGTATTACTAAACGAGCTGAGATCTCCTTCTGAACTGTTGGATTT
TGGTGAATTCTCTGATTGTCTGGATTTTGGAACGGGTTCCGGGTCTCCCCTTCTTCAAGTTGTCAACCCAACATTCGATT
ACGTCCCACCAAGCCTTGTTAGTCTATTCATAACCGATACGGGAGGACACAACCCATCTTACATGTACCGTCTTATTGCC
GACTACTACTCTGCTGATGATTTGGTGATGTAG