Details for Chinese cabbage Locus Brara.E03216

Position : A05 ( 5`- 26162976 .. 26164936 -3` )
Annotation :
External links : CoGe
PGDD synteny : Brara.E03216

Protein [Map View]
MWSTQTLAIKYLHSSLLASSQTKKKNTSTSSTIMSVLHLLTLSLLISISGAKFSGRPGVNYGQLGNNLPSPSDSVTLIKS
LNAKSVKLYDANPSILAALNATDIVVSVMVPNELIVNITKSKTLSDDWIKSNVLPFYPSTKIRYLLVGNEILSSQDSELK
SALVPAMRKIQRSLKTLGVKKVKVGTTLAMDVLNSSYPPSSGEFRSDISGSVMKPMLQFLNRTKSFLFVDVYPYFAWAQD
PAHINLDYALFESTNVTVMDPVTNLTYHNLFDQMIDAFVFAMKRLGYPDLRIWVAETGWPNNGDYDQIGANIYNAATYNR
NVVKKLAAEPPVGTPARPGKVLPSFIFALYNENQKTGPGTERHFGLLHPNGSQVYEIELSGKTTEYKESLPAPENNEGYK
GKIWCVVAKGANWTQLGDALSYACSQGNNTCDSIKPGGSCHKPDLMVFHASYAFSSYWASFRKVGGTCYFNGLATQTIKD
PGYGRCEFPSVTL*

DNA
ATGTGGAGCACGCAAACACTAGCCATTAAATATCTCCACTCTTCTCTCCTAGCTTCTTCACAGACGAAGAAGAAGAACAC
ATCTACCAGCTCTACCATCATGAGTGTTCTACATCTCCTCACTCTCTCCCTCCTCATCTCCATTTCAGGAGCCAAGTTCT
CCGGCCGACCAGGAGTCAACTACGGCCAGCTCGGAAACAACCTCCCGTCCCCCTCCGACTCAGTCACCCTCATCAAATCC
CTAAACGCGAAAAGCGTCAAGCTTTACGACGCCAACCCATCAATCCTCGCCGCACTAAACGCCACCGACATCGTCGTCTC
CGTAATGGTCCCCAACGAGCTCATCGTCAACATAACCAAATCCAAAACCCTCTCCGACGACTGGATCAAATCCAACGTCC
TCCCTTTCTACCCCTCCACCAAGATCCGCTACCTCCTCGTCGGCAACGAGATCCTCTCCTCCCAAGACTCCGAGCTCAAA
TCCGCTCTAGTTCCAGCAATGCGCAAGATCCAACGCTCGTTGAAGACCCTCGGCGTTAAAAAAGTCAAAGTGGGGACCAC
CCTCGCCATGGACGTTCTCAACTCCTCCTATCCACCTTCCAGCGGCGAGTTCCGGTCCGATATTTCCGGTTCGGTTATGA
AACCGATGCTACAATTCTTAAACCGGACGAAATCGTTTTTATTCGTCGACGTGTACCCGTACTTCGCTTGGGCCCAAGAC
CCGGCCCATATAAATCTCGATTACGCCCTTTTCGAGTCCACCAACGTAACTGTAATGGATCCGGTGACGAATCTTACTTA
CCACAACCTCTTTGATCAGATGATCGACGCTTTCGTCTTCGCGATGAAGCGCCTCGGGTATCCGGATCTTCGGATCTGGG
TCGCGGAAACGGGCTGGCCCAATAACGGAGACTACGACCAAATCGGAGCGAATATCTACAACGCCGCCACTTATAACCGT
AATGTGGTCAAGAAACTCGCCGCCGAGCCGCCTGTTGGTACTCCGGCGAGGCCCGGGAAGGTTCTCCCGTCGTTTATTTT
CGCGCTTTACAACGAGAATCAGAAAACGGGTCCGGGTACGGAGCGGCATTTCGGGCTCTTGCATCCGAACGGGAGTCAGG
TTTACGAGATTGAGTTGTCGGGGAAGACGACGGAGTATAAGGAGTCTTTGCCGGCGCCGGAGAATAATGAGGGGTACAAG
GGGAAGATATGGTGCGTTGTGGCGAAAGGAGCGAATTGGACTCAGCTTGGTGATGCTCTATCGTACGCTTGCTCGCAGGG
GAATAATACCTGTGATTCGATTAAACCGGGTGGATCATGTCACAAACCGGATTTGATGGTTTTCCACGCTAGCTACGCGT
TTAGCTCTTATTGGGCTAGCTTTCGGAAGGTCGGTGGGACTTGTTACTTCAATGGGCTCGCCACTCAGACCATTAAAGAT
CCAGGCTACGGACGCTGCGAGTTTCCGAGCGTGACATTGTGA